KEGG   Butyrivibrio fibrisolvens: CIY_22490Help
Entry
CIY_22490         CDS       T02581                                 

Definition
Beta-1,4-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
bfi  Butyrivibrio fibrisolvens
Brite
Enzymes [BR:bfi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     CIY_22490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2052786..2056247)
Genome map
AA seq 1153 aa AA seqDB search
MIDFDRDYNKGGSWGTDIIVSGGAFKISFSGQYAEKVLGLPEGISGKQVKAVKVNIKKGE
VSKFTVKLRNNGEEVKPAYGTNVIENSDKQDFDGIGLMTTADGGANYTITSITLTLAGEE
SDFPKPSEVTEEEEKVEIERDIPDLKDSVSSSKGLGEDCYTGAAIMISEINDKALMALVE
KHFNAVTFGNEFKPDSLFGYNNSKPADGQIITETWTDAKGVTHKDMKVPKMDFSRPEKML
ALLKDWNDEHPDDQIKVRGHVLTWHSQTPEWFFKENYDPNGEWVSPEEMTLRHEWFIKSV
FEHVFSSEYKDMFYGWDVVNEACSDGSGTYRSADPSERSNWARIYGIGSKKDAPDYILNA
FRFANYYAHEMGQDKLELYYNDYNECSGNKPDAIAQLLESVKRHEKDSVLPTRISGYGMQ
GHHNMLSATKQQIIDCGIRYGKIVGKIQVTELDFKCSSDFGGTDAELSAEYTKEAYRYKD
VYDAYKEIDAQPGIDVNGFTVWGVIDPNSWLQTSSSVGGGANGRQKQVPLLFDGEYKAKP
AYWALVDPSKLEPAINSITLVQGTGSDIFAHGKNVSIAGTDYSFIPVWTDNKLSVKVKAN
GASSAKLYVDFAQAMKDGADVKTAESALNENGECVLEVETTDPLVVSSKIALDVVVTDAE
GDHAFNNLRLTHDDGSKFFAKGLCKPYMSVVKGTPEVDGKTDDVWANAQDVELTITGGTK
PNAKASAKVLWDDKNLYVLMNVKDDVLDASAEAVHEKDSVEVFIDENNNKSSKFEDDDKQ
YRINYLNETSFNGTKCLEENCQHAVTVTDDGYVVEAAFAWTDITPVAGQTIGFDLQINDG
ANGGRIGTRTWYDETGNGWSAPSVYGEVALVDAEEEPEEPVVEEPAITMVEDCVYTGKAL
KPEVVVTVGGKTLVKGIDYKVSYKNNKNAALKVSTGMGEDFDENLPTVIVKLKGEYEGEL
KANFSIAAADFSGENFEFIAPKNLKEKKWATKPEVTVKYLGKKLSKNDFTVTYKLGKNGK
EMKQLPARASNGDGKYYAVIKAAGTNFTGTKEVALNIIADAQVNILFAHVKNWDVKWDRR
ANRLTLNMNYKVNANDEASYFGVKKGTVVELKEGKDYNAYMVQYCGFLGLGLARVDGRDP
FYGVRFVIVHVTR
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
atgattgattttgacagagattataacaaaggcggctcttggggaacagacatcattgta
agtggtggcgcctttaagatttcatttagtggacagtacgctgagaaagttttaggttta
ccagagggaattagtggtaagcaggttaaggctgttaaggttaacatcaaaaagggtgaa
gtaagcaaatttacagttaagcttcgcaacaacggcgaagaggttaaaccagcttatggc
actaatgttattgaaaattcagataagcaggattttgatggaatcggcttaatgacaaca
gctgatggtggagcaaattacactatcacaagcattactcttacattagctggtgaggaa
agcgatttccctaagccatctgaggtaacagaggaagaggaaaaggttgagattgagcgc
gacattcctgatttaaaggattctgtatcttctagcaagggacttggcgaggattgctac
acaggtgcagctatcatgatttctgaaatcaatgataaggcacttatggcccttgtagag
aagcattttaatgctgtaacatttggtaatgagttcaagccagactcattatttggatac
aataatagcaagccagcagatggacagatcatcactgagacatggacagatgctaagggt
gttactcataaggatatgaaggttcctaagatggacttctctcgtccagagaagatgctt
gcacttctcaaggattggaatgatgagcatccagatgaccagataaaggtaagaggtcac
gttcttacatggcactcacagacacctgaatggttcttcaaggagaactatgatccaaac
ggtgagtgggtatctccagaggagatgactcttcgtcacgagtggttcattaagagtgta
ttcgagcatgtattctcatcagagtacaaggatatgttctatggatgggatgttgtaaat
gaggcatgctctgatggctctggcacatacagaagtgcagatcctagcgaaagatcaaac
tgggctagaatttatggtattggtagcaagaaggatgcaccagattacatccttaatgca
tttagattcgcaaactactatgcacacgagatgggccaggataagcttgagctttactac
aatgattacaatgagtgctcaggcaacaagccagatgcaatcgctcagttacttgagagc
gtaaagagacacgagaaggattcagttcttcctacaagaatctcaggatatggtatgcag
ggacatcacaatatgctttctgcaacaaagcagcagattattgactgtggtatcagatac
ggtaagattgttggaaagattcaggtaacagagcttgatttcaagtgcagctcagacttt
ggtggtacagacgcagagctttctgctgagtacacaaaggaagcttacagatacaaggat
gtttatgatgcatacaaggaaattgatgcacagcctggtatcgatgtaaacggctttaca
gtttggggtgtaatcgatcctaactcatggcttcagacaagcagcagcgttggtggtgga
gctaatggaagacagaagcaggtaccacttcttttcgatggtgagtacaaggctaagcca
gcatactgggcacttgttgatccaagcaagcttgagccagctatcaacagcattacatta
gtacagggcacaggctcagatatctttgctcacggtaagaatgtaagcattgctggtaca
gattacagcttcattccagtatggactgacaacaagctttctgtaaaggttaaggcaaat
ggcgctagctcagcaaagctttatgtagattttgcacaggctatgaaggatggcgctgat
gttaagacagcagaatcagctttgaacgaaaatggtgagtgcgttcttgaggttgagaca
actgatccattagttgtttcttctaagattgcgttagatgtagttgttactgatgcagag
ggtgaccatgcattcaacaacttaagacttacacatgacgatggcagcaagttctttgca
aagggtctttgcaagccatatatgtcagtagttaagggtacaccagaggttgatggtaag
actgatgatgtttgggctaatgctcaggatgttgagcttacaatcacaggtggcacaaag
cctaacgcaaaggctagtgcaaaggttctctgggatgataagaatctctatgttcttatg
aacgtaaaggatgatgttctcgatgcaagtgcagaggcagttcacgagaaggattctgtt
gaagtatttattgatgagaacaacaataagtcatctaaattcgaagatgatgacaagcag
tacagaattaactacttaaatgagacaagctttaatggtacaaagtgccttgaggaaaat
tgccagcacgctgttacagtaacagatgatggttatgtagttgaggcagcttttgcttgg
acagatattacaccagtagcaggtcagacaatcggttttgatttacagattaatgatggc
gcaaacggtggacgtattggtacaagaacatggtatgatgagacaggtaacggctggagc
gcaccaagcgtttatggcgaggtagctttagttgatgctgaggaagagccagaagagcca
gtagttgaggagccagctatcacaatggtagaggactgcgtatacacaggcaaggctctt
aagccagaggtagttgtaactgttggtggtaagactcttgtaaaaggcattgattacaag
gtttcttacaagaataataagaatgctgctcttaaggtaagcacaggtatgggcgaggat
ttcgatgagaatcttcctacagtaattgttaagcttaagggtgaatatgagggcgagctt
aaggcaaacttctctattgcagcagcagacttctcaggtgagaactttgagtttatagct
ccaaagaatcttaaggaaaagaagtgggctacaaaacctgaggtaacagttaagtatctt
ggaaagaagctttctaagaatgacttcacagttacatacaagcttggaaagaatggcaaa
gagatgaagcagcttcctgcaagagcttcaaatggtgatggaaaatactatgcagttatc
aaggctgctggaacaaacttcactggcactaaggaagtagctcttaatatcattgctgat
gctcaggtaaatatccttttcgcacacgttaagaattgggatgtaaagtgggatagaaga
gcaaacagacttactttaaatatgaactacaaggttaacgcaaatgatgaggcttcatat
tttggcgttaagaagggtacagtagttgaattaaaggaaggcaaagattacaacgcatat
atggtacagtactgtggattcttaggcttaggtttagctagagttgacggtcgcgaccca
ttctatggtgtaagatttgttattgtacacgttacaagataa

DBGET integrated database retrieval system