KEGG   Candidatus Blochmannia floridanus (Camponotus floridanus): Bfl034Help
Entry
Bfl034            CDS       T00138                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bfl  Candidatus Blochmannia floridanus (Camponotus floridanus)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:bfl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Bfl034 (holC)
   00240 Pyrimidine metabolism
    Bfl034 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Bfl034 (holC)
   03430 Mismatch repair
    Bfl034 (holC)
   03440 Homologous recombination
    Bfl034 (holC)
Enzymes [BR:bfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Bfl034 (holC)
DNA replication proteins [BR:bfl03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Bfl034 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(41257..41718)
Genome map
AA seq 153 aa AA seqDB search
MIYKQGTFYLLPFIHHKNDLNTIEQLVCHLTKIHWRLGKTILITCDTHDQAKKINEALWN
FEKNSFLPHGLFSKNTYNIPITIYWSQCCYDNKYRNTLINLMQKNKNFFLNFHEIIDFVP
NEDNLKKLARIRYKSYRSLGFNLKTTHISTKNQ
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgatatacaaacagggaacattttacttattaccattcatacatcataaaaatgaccta
aacactatagaacaattagtatgtcatttaacaaaaatccactggagacttggaaaaact
atattaataacatgcgacactcacgatcaagcaaaaaaaatcaatgaagccttatggaac
tttgaaaaaaattcatttttaccacatggactatttagtaaaaatacatataatattcca
attactatatactggagccagtgttgttatgacaataaatacagaaatacactaattaat
cttatgcaaaaaaacaaaaatttttttttaaattttcatgaaataattgactttgttcct
aatgaagataacctgaaaaagctagctagaatacgatataaatcctatagaagtcttggt
tttaacttaaaaacaacccacatatccacaaaaaatcaatga

DBGET integrated database retrieval system