KEGG   Candidatus Blochmannia floridanus (Camponotus floridanus): Bfl088Help
Entry
Bfl088            CDS       T00138                                 

Gene name
cysQ
Definition
cysQ protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
bfl  Candidatus Blochmannia floridanus (Camponotus floridanus)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bfl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Bfl088 (cysQ)
Enzymes [BR:bfl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Bfl088 (cysQ)
Transfer RNA biogenesis [BR:bfl03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Bfl088 (cysQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
93801..94589
Genome map
AA seq 262 aa AA seqDB search
MIVDQIIYIARIAGMEIMRIYTGFGHRKIYVQQKMDQSPVTNADLIAHQVIVYLLRNLTP
NIPIISEECIPEWRDCRHWNNFWLIDPLDGTKEFLSRNGEFTVNIAFIQNGEPTIGVVYV
PVYDVLYVANYGQAWKINSIGKQELLNITDYTYMSRYKNPLVVMSRTCISEYDQKLLNDY
LMQIKNYKIVNIGSSFKFCLVAEGIAHFYPRFSSTKIWDTAAGHAIAKAAGALVNDWNGY
PLNYSSINKYFLNPGFQVSLCS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgatagtagatcaaataatttatattgctcgtatagctggaatggaaataatgagaatt
tatacagggtttggacatcgtaaaatatatgtacaacaaaaaatggatcagtctcctgta
accaatgctgatttaattgcgcatcaagttatcgtatatttattacggaatttaactcct
aatattcctattatatcagaagagtgtattccagagtggagagactgtaggcattggaat
aatttttggttaattgatcctctagatggaactaaagaatttttatctcgtaatggtgaa
tttactgtaaatattgcttttatacaaaatggagaacctaccataggagtagtatatgtt
ccagtgtatgatgtgttgtatgttgctaattatggtcaagcttggaaaattaattccatt
gggaaacaagaattattaaatattactgattatacttatatgtctagatataaaaatccc
cttgtcgtaatgagtagaacgtgtatatctgagtatgatcaaaagttattaaatgattat
ttaatgcagattaaaaattataaaattgttaatattggttcatcgtttaaattttgttta
gtagcagaagggatagcacatttttatccgcggttttcctcgactaaaatttgggatacc
gctgctggacatgctattgctaaagcagctggagctttagttaatgattggaatggatat
cctttaaattatagtagtattaataaatattttttaaatcctggatttcaagtatcactg
tgtagttaa

DBGET integrated database retrieval system