KEGG   Candidatus Blochmannia floridanus (Camponotus floridanus): Bfl110Help
Entry
Bfl110            CDS       T00138                                 

Gene name
holD
Definition
DNA polymerase III subunit psi (EC:2.7.7.7)
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
bfl  Candidatus Blochmannia floridanus (Camponotus floridanus)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:bfl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Bfl110 (holD)
   00240 Pyrimidine metabolism
    Bfl110 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Bfl110 (holD)
   03430 Mismatch repair
    Bfl110 (holD)
   03440 Homologous recombination
    Bfl110 (holD)
Enzymes [BR:bfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Bfl110 (holD)
DNA replication proteins [BR:bfl03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Bfl110 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
121590..121997
Genome map
AA seq 135 aa AA seqDB search
MNVDVVLKRLDITLWKIRYPAILKKSESVQLLINLRFLIISGLFISLDDPFVQDVIRAMR
VKNIEVYIININEINNLILPVKVLNYCWWVGVEVLCDFGGISLCTESLNVLKYDMKGKQD
FWYQIYRNVYCDWSK
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtagatgtagttttgaaaagattagatattacgttatggaaaattcgatatccc
gctatattgaaaaaatcggaatcagtacagttgttaataaatttacgttttttaataatt
tctggtttatttatttctttggatgatccctttgtacaagatgtgattcgtgctatgcgt
gtaaaaaatatagaagtgtatataattaatattaatgagattaataatttaattttacct
gtaaaagttttaaattattgttggtgggttggagtggaagttttatgtgattttggagga
atatctttatgtactgaatcattaaatgtattaaaatatgatatgaaaggtaaacaagat
ttttggtatcaaatttatcgtaatgtatattgtgattggagtaaataa

DBGET integrated database retrieval system