KEGG   Candidatus Blochmannia floridanus (Camponotus floridanus): Bfl113Help
Entry
Bfl113            CDS       T00138                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bfl  Candidatus Blochmannia floridanus (Camponotus floridanus)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bfl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bfl113 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bfl113 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bfl113 (thrC)
Enzymes [BR:bfl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bfl113 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
125876..127207
Genome map
AA seq 443 aa AA seqDB search
MKLYNIKQREETVNFLHALIQGLGKNQGLFFPVDLPRFSISEIDNLLGMQFVERSAYILS
KFIGSEFSQNCILNCVEKAFNFPVPLNFIKKNVAILELFHGPTLAFKDFGSRLMAQMLLI
TMETHRYEQEKPMVILTATSGDTGAAVAHAFYGLDNIHVIILYPRNKISILQEKLFCTLG
ENISTISVEGDFDICQDLVKKSFNDDLLKKMLYLNSANSINISRVLAQVCYYFEALAQID
YERRYHNNLIISVPSGNFGNLTAGLLAQSSGLPIKNFIAATNINDTVPRFLTSGLWNPLP
TISTFSNAMDVSCPSNWSRIEELFRRENRSIFELQFGSVNDELIKKTVQEVANLGYICDP
HTAVAYRLLDDQLCSDEFGICLGTAHPAKFKELVECFLEDKVSLLVPNALKKHMILPVLS
HKISGSFAELRDLIYDITVKSDI
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatataatattaaacaacgtgaagaaacggttaattttttacatgctcttata
cagggtttaggtaagaatcaaggattattttttccagttgatttgcctaggttttcaatt
tctgaaattgataatttattaggaatgcagtttgtagaacgtagtgcatatatattatct
aaatttataggatctgagttttcacaaaattgtattttaaattgtgtagaaaaagcgttt
aattttccggttccactaaattttattaaaaaaaatgttgcaattttagaactttttcat
ggaccgactttagcatttaaagattttggtagtcgattaatggctcaaatgttattgata
actatggaaacacataggtatgaacaagaaaaacctatggttattcttactgctacttct
ggagatactggagcagctgtagcccatgcattttatggattagataatatacatgtgatt
attttgtatcctagaaataagattagtatattacaagaaaaattattttgtacattgggt
gaaaatatatcaactatatcggtagaaggagattttgatatttgtcaagatttggttaaa
aaatcttttaatgatgatttattaaaaaaaatgctgtatttaaattctgctaattctatt
aatatcagtagggtattagcacaggtttgttattattttgaagcattggctcaaattgat
tatgaaagacgatatcataataatttgattatttcagttcctagtggaaattttggtaat
ttaacagcaggtttgttagctcagagttctgggttgcctataaaaaattttattgctgcg
accaatatcaatgatacagtacctagatttttaacatctggactgtggaatccattacct
actatttcaactttttctaatgctatggatgtgagttgtcctagcaattggagtagaata
gaagaattatttagacgggaaaataggtctatttttgaattacagtttggtagtgtaaat
gatgaattaataaaaaaaacagtgcaagaagttgcaaatttgggatatatttgtgatcca
catactgcagtagcgtatcgattattggatgatcagttatgttctgatgaatttggaata
tgtttgggaactgctcatccagctaagttcaaggaattggtagaatgttttttagaggat
aaagtaagtttgttagtacccaatgctctgaaaaaacatatgatattaccagttctttca
cataaaatatcggggagttttgctgaattaagggatttgatttatgatataaccgtaaaa
tctgatatctag

DBGET integrated database retrieval system