KEGG   Candidatus Blochmannia floridanus (Camponotus floridanus): Bfl146Help
Entry
Bfl146            CDS       T00138                                 

Gene name
ftsZ
Definition
(GenBank) cell division protein FtsZ
  KO
K03531  
cell division protein FtsZ
Organism
bfl  Candidatus Blochmannia floridanus (Camponotus floridanus)
Brite
Chromosome [BR:bfl03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    Bfl146 (ftsZ)
Cytoskeleton proteins [BR:bfl04812]
 Prokaryotic cytoskeleton proteins
  Microtubules homologs
   Bfl146 (ftsZ)
Prokaryotic defense system [BR:bfl02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Bfl146 (ftsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
168893..170068
Genome map
AA seq 391 aa AA seqDB search
MFEPIELTSDAVIKVIGIGGGGSNAVEHMLRERIEGVDFFAVNTDAQALRKMIVGQTIQI
GSSITKGLGAGSNPEIGRNSAEEDRDVLRSTIEGADMVFIAAGMGGGTGTGAAPVVAEVA
KDLGILTVAVVTKPFNFEGKKRMMFAEQGITELSKYVDSLITIPNDKLLKVLGRGISLLD
AFSAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVGCGDDRAEEAS
ELAIASPLLEDIDLSGARGVLVNITSGLDLRLDEFETVGNTIRSFASDNATVVIGTALDP
DIKNDELRVTVVATGIGVDKNLENTLPTADHLEEQKMVKESHYNNHAIQKQRKSAFFNES
QHDTSSNVVSHDNSILDKDMDYLDIPAFLRK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaaccaatagagttaactagtgatgcggtaattaaagtcattggtattggtgga
ggaggtagcaatgctgtggaacatatgttacgggaacgtattgaaggggtggattttttt
gcagtaaacactgatgctcaagctttacggaaaatgattgtaggccagactattcagatt
ggtagttctattactaaaggattaggggcaggatctaatccagaaattggtcgaaattct
gcagaagaagatcgagatgtgttgagatctacgatagaaggggctgatatggtgtttatt
gctgctggtatggggggaggtacgggaactggagcagctccagttgtagcagaagtggca
aaagatttaggaattttaacagttgctgtagttactaaaccttttaattttgaaggaaaa
aaacgtatgatgttcgctgaacaaggtattactgaattatctaaatatgtagattcatta
attactattcctaatgataagttattaaaagttttaggacgaggtatatcattacttgat
gcctttagcgcagctaatgatgtattaaaaggggcggtacagggtattgctgaattgatt
actaggcctggtttaatgaatgtggattttgcagatgtacgtactgtaatgtcagaaatg
ggatatgctatgatgggctcaggagtaggatgcggagatgatagagcggaagaggcatct
gagttagctattgctagtccattattagaagatattgatttgtctggagctcgaggggta
ttagtaaatattacttctggtttagatttaagattggatgaatttgaaacagtgggtaat
actatacggtcttttgcgtcagataatgcaactgtagtaataggaacagctttagatcct
gatataaaaaatgatgaattgagagtgacggtagttgcaacaggaattggagttgataag
aatttagaaaatacattacctactgccgatcatttagaagaacagaaaatggttaaagaa
agtcactataataatcatgcaatacagaagcaaagaaaatctgctttttttaatgaatct
caacatgatacatcatcgaatgtagtaagtcatgataattctattttagataaggacatg
gattatttagatattcctgcatttttaaggaaatga

DBGET integrated database retrieval system