KEGG   Candidatus Blochmannia floridanus: Bfl150Help
Entry
Bfl150            CDS       T00138                                 

Gene name
folK
Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
bfl  Candidatus Blochmannia floridanus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bfl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
175495..175989
Genome map
AA seq 164 aa AA seqDB search
MEYAWIGIGSNLLNPKKQVDQAIQALSQLPKTEFISCSKYYRSRPLGYHKQPDFLNTIVI
LYTDLRPELLLDYMQEIENQQGRVRKFATCCNSYPRTLDLDILLFGQYRICTPKLVIPHY
DMMNREFIMYPLAELDQKLVLPNGKCIADIIRGFPKKGLTIWDN
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggaatatgcttggattggaataggtagtaatttattaaatccaaaaaaacaagtagat
caagcaatacaggctttatcgcaacttccaaaaactgaatttatttcgtgttcaaaatat
tatcgtagtcgtccattaggttatcataaacagcctgattttttaaatacaatagttata
ttatatactgatttgagaccagaattattattagattatatgcaggaaatagagaatcaa
caaggacgagttcgaaagtttgcaacgtgttgtaatagctatcctcgtacattagattta
gatattttattgtttggtcaatatagaatatgtacaccaaaattagttatcccgcattat
gatatgatgaatagagaatttattatgtatcctttagctgagttggatcaaaaattagtt
ttgcctaatgggaaatgtattgcagatattattagaggttttcctaaaaagggattaact
atttgggataattaa

DBGET integrated database retrieval system