KEGG   Candidatus Blochmannia floridanus (Camponotus floridanus): Bfl253Help
Entry
Bfl253            CDS       T00138                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bfl  Candidatus Blochmannia floridanus (Camponotus floridanus)
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bfl253 (speB)
Enzymes [BR:bfl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Bfl253 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
269924..270835
Genome map
AA seq 303 aa AA seqDB search
MCTLMHKHDDSLFSNSFGFLRLPLEFYPYTRHNDWVITGVPFDIATSGRSGSRFGPASIR
KASINLAWENCRWPWNFDIRQKLKIIDCGDLIYKSGNVQDFTNILQKHIENLLRFRKKIL
LLGGDHYITLPVLRAYSKFFGTISIIHFDAHADYYDNNNQYDHGAVILYALHEKLINPNR
SVQIGIRTEYDKNFGFTVLDAEYVNTTAVHVLINQIVSVIQNRPVYLTFDIDCLDPSVAP
GTGTPVIGGLTTSCALQIIRGFQKLNIIGIDIVEVAPVYDCAQITALAAATLGLEMLYTQ
VKF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtgcactttaatgcataaacatgatgattctttgttttcaaattcgtttggattttta
agacttccgttggagttttatccttatactcgacataatgattgggtaattactggagta
ccttttgatatagcaacttctggaagatcgggaagtagatttggtccagcatctattcga
aaagcatctatcaatttggcgtgggagaattgccgttggccttggaattttgatatacgt
caaaaattaaaaattattgattgcggagatttaatatataaatcaggaaacgtacaagat
tttacgaatattttacaaaagcatattgaaaatttattgcgttttagaaaaaaaatcctt
ttattaggaggagatcattatattacgttacctgtattacgtgcgtactcaaaatttttt
gggacaatatccattattcattttgatgctcatgcagattattacgataataataatcaa
tacgatcatggggctgttatactgtatgctttacatgaaaagttgattaatcctaatcgt
tcggtccaaattggtattcgtactgaatatgataaaaactttggatttacagtattggat
gcggagtatgtaaatacaactgctgttcatgttcttattaatcagattgtatctgttata
caaaataggccggtgtatttaacttttgatattgattgtttggatccatcagttgctcca
ggtactggtactccggtaattggagggttaactacatcttgtgcattacaaataatacga
ggatttcaaaaattaaatattattggtattgatatagttgaagttgctccagtttatgac
tgtgctcaaattactgcattagctgctgctacattggggttagaaatgttatacactcaa
gtaaagttttaa

DBGET integrated database retrieval system