KEGG   Candidatus Blochmannia floridanus (Camponotus floridanus): Bfl328Help
Entry
Bfl328            CDS       T00138                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bfl  Candidatus Blochmannia floridanus (Camponotus floridanus)
Pathway
bfl00020  Citrate cycle (TCA cycle)
bfl00190  Oxidative phosphorylation
bfl00650  Butanoate metabolism
bfl01100  Metabolic pathways
bfl01110  Biosynthesis of secondary metabolites
bfl01120  Microbial metabolism in diverse environments
bfl01130  Biosynthesis of antibiotics
bfl01200  Carbon metabolism
Module
bfl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bfl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bfl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bfl328 (sdhD)
   00650 Butanoate metabolism
    Bfl328 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    Bfl328 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CAD83395
UniProt: Q7VR94
Position
362582..362929
Genome map
AA seq 115 aa AA seqDB search
MESMKLNHKYYGVYEWLIVRISAILTILYSVYLFNFINIDDNFSYEKWCIFFYDKKIKIF
NTIVLLMLLKHTWIGMRHILEDYISSIILRRLSIGLIHIILYVYLLFGIAVVWGI
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggaatccatgaaattaaatcacaaatattatggggtatatgaatggttgatagtaaga
atttccgctatattgacaatattatatagtgtatatttgtttaattttattaatattgat
gataatttttcttatgagaaatggtgtatatttttttatgataaaaaaataaaaatattt
aataccatagttttattaatgttattaaaacatacttggattggtatgagacatatatta
gaagactatatatcatcaataatattaagacgattaagtatcggtctaattcatattata
ttatatgtatatttattgtttggaatagctgtcgtttggggtatataa

DBGET integrated database retrieval system