KEGG   Candidatus Blochmannia floridanus: Bfl328Help
Entry
Bfl328            CDS       T00138                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein (EC:1.3.99.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bfl  Candidatus Blochmannia floridanus
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:bfl01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bfl00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:bfl00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:bfl00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
362582..362929
Genome map
AA seq 115 aa AA seqDB search
MESMKLNHKYYGVYEWLIVRISAILTILYSVYLFNFINIDDNFSYEKWCIFFYDKKIKIF
NTIVLLMLLKHTWIGMRHILEDYISSIILRRLSIGLIHIILYVYLLFGIAVVWGI
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggaatccatgaaattaaatcacaaatattatggggtatatgaatggttgatagtaaga
atttccgctatattgacaatattatatagtgtatatttgtttaattttattaatattgat
gataatttttcttatgagaaatggtgtatatttttttatgataaaaaaataaaaatattt
aataccatagttttattaatgttattaaaacatacttggattggtatgagacatatatta
gaagactatatatcatcaataatattaagacgattaagtatcggtctaattcatattata
ttatatgtatatttattgtttggaatagctgtcgtttggggtatataa

DBGET integrated database retrieval system