KEGG   Candidatus Blochmannia floridanus (Camponotus floridanus): Bfl332Help
Entry
Bfl332            CDS       T00138                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase component (E2) (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bfl  Candidatus Blochmannia floridanus (Camponotus floridanus)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bfl332 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bfl332 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    Bfl332 (sucB)
Enzymes [BR:bfl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bfl332 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
368546..369862
Genome map
AA seq 438 aa AA seqDB search
MSDSSKLDILVPNLPESVIDATVSVWHKKEGDKIKQGEILLEIETDKIMLEVPALQSGIL
LEILEKSGSIVIAGQILGRLECNNFSNQIKPLNFSDNQNSIKSTIAKKIEDNLVIQEEDK
HSPISPVIRKLITKYNLNIDNIKGSGIKGRLTRQDIETYIQKNTLSQTYNVAINTDFKQS
IYDNAQQKNDFTHDNRVNTIRNDVNNRTDTRVIMSRLRKKISERLLKVTNSTAILTTFNE
VNMQCIINIRNKYQESFEKNHNIKLGFMSFFVKAVVEGLRRFPEINAYIDGEEIIYHNYF
DISIAVSTPRGLVTPVLRNADKLRFVDIEKNIKLLANKGKTGKLTLDDLNGGNFTITNGG
IFGSLLSTPIINPPQSAILGMHAIKDRPMALNGNIVILPMMYLALSYDHRLIDGKDSVNF
LITVKNLIEDPMSLLLEN
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatagtagtaaattagatatattagtacccaatttacctgaatcagtgatagat
gccactgtttcggtatggcataaaaaagaaggagataaaattaaacaaggggaaatatta
cttgaaattgaaacagataaaattatgttagaagtccctgctttacaatcaggtatatta
ttagagatattagaaaaatcaggatctattgttatagccggccaaatcttaggacgttta
gaatgtaataatttttctaaccaaataaaaccactgaattttagcgataatcaaaatagt
ataaaatctactattgcaaaaaaaatcgaagataatcttgttatacaagaagaagataag
cattccccaattagtccagtaattcgaaaattaattactaaatataatttaaatatagac
aatataaaaggtagcggaattaagggacgtcttactagacaagatatagaaacatatatt
caaaaaaatacattatcgcaaacgtataatgttgctataaatacagactttaaacagtcc
atatatgacaatgcacaacaaaagaatgattttactcatgataatagagttaataccata
agaaatgatgttaataatcgtacagatacacgcgtcataatgagtcgtttacgaaaaaaa
atttcggaaaggttattaaaagtaacgaattctactgctatattaactacttttaatgaa
gtaaatatgcaatgtattattaatatacgaaataaatatcaagaatcatttgaaaaaaat
cataatattaagttagggtttatgtctttttttgtaaaagcagttgtagaaggattacga
cgttttcctgaaatcaatgcatatattgacggggaagaaataatatatcataattatttc
gatataagtattgcagtatctacaccaagaggattagttactccagtattaagaaatgct
gataaattgaggtttgttgacatcgaaaaaaatattaaattattagctaataaaggaaaa
acaggaaaattaacacttgacgatttaaatggaggaaactttacaattactaatggaggt
atttttggttcattactctctactcctataattaatcctccacaaagtgctattcttgga
atgcacgctattaaagatcgaccaatggcattaaacggaaatatagtaatattacctatg
atgtatttggcattatcatatgatcatcgattaatagatggaaaagattcagttaatttt
ttaataactgttaagaatttaatcgaagatccaatgagtttattattggaaaattaa

DBGET integrated database retrieval system