KEGG   Candidatus Blochmannia floridanus (Camponotus floridanus): Bfl342Help
Entry
Bfl342            CDS       T00138                                 

Gene name
gpmA
Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bfl  Candidatus Blochmannia floridanus (Camponotus floridanus)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bfl342 (gpmA)
   01230 Biosynthesis of amino acids
    Bfl342 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bfl342 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Bfl342 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bfl342 (gpmA)
Enzymes [BR:bfl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bfl342 (gpmA)
Exosome [BR:bfl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bfl342 (gpmA)
  Exosomal proteins of melanoma cells
   Bfl342 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
378754..379452
Genome map
AA seq 232 aa AA seqDB search
MHIIKTVLIRHGESQWNKDNRFTGWIDVDLSNQGYSEAKRAGQLLKKYKFIFDYGYTSVL
KRTIHTLWVILDQLNQTWLPIQKVWQLNERHYGALQGLNKNEAIKTYGYDTIQKWRRSFK
DIPPKNNKNDLFLGTNDIRYKNIETNTLPNGESLELTANRVIPYWQKYIEPKIYNNNCII
IVAHGNSIRAILKFLNQLDDSEIFNIEIPTGIPLIYEFDNNIKPIRYYYLSE
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgcatataattaaaacagtattaattagacatggagaaagtcaatggaataaagataat
cgatttaccggatggatagacgttgatttatcaaatcaaggttattctgaagctaaacgc
gctggccaattattaaaaaaatataaatttattttcgattatggatatacttctgtatta
aaacgaactatacatactttatgggttatattggatcaattaaatcaaacatggttacct
atacaaaaagtatggcagttgaatgaacgccattatggagcattacaaggattaaataaa
aatgaagcaattaaaacatatggatatgacacaattcaaaaatggcgtcgcagttttaaa
gatattcctccaaaaaataataaaaatgatttatttttaggaactaatgatatacggtat
aaaaatattgaaactaatacattacctaatggggaaagtttagaattaacagcaaataga
gttatcccatattggcaaaagtatatagaaccaaaaatttacaataataattgtattatt
attgttgctcatggaaattctataagagctattttaaaatttttaaatcaattagatgat
tctgagatatttaacattgaaattcctacaggaattccattaatatatgaatttgataat
aatataaaacccattcgatattattatctatctgaataa

DBGET integrated database retrieval system