KEGG   Candidatus Blochmannia floridanus (Camponotus floridanus): Bfl430Help
Entry
Bfl430            CDS       T00138                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bfl  Candidatus Blochmannia floridanus (Camponotus floridanus)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bfl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bfl430 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bfl430 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bfl430 (trpB)
Enzymes [BR:bfl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bfl430 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
470124..471320
Genome map
AA seq 398 aa AA seqDB search
MTQQLHSYFGEFGGMYVPQILIPALIQLEKEFIEAMKDISFQTTFKNLLHHYAGRPTPLT
LCQNLTSGTCSKLYLKREDLLHGGSHKTNQVLGQALLAKRMHKKEIIAETGAGQHGVAVS
IASSLLKLKCRIYMGYKDMKRQELNVLRMKLMGTQVIPVHHGSATLKDACNEAIREWSST
YKHTHYMIGTVAGPHPFPTIVKEFQRIIGSETYNQIQTHEKKLPDAVIACIGGGSNAIGI
FSGFIDIPSVQLLGVEAGGLGLHTEYHGSSLQCGETGIYFGMKSPILQSQEGQIKNSYSI
AAGLDFPSVGPEHAYLKKINRVKYVSINDEEAINAFQELSLYEGIIPALESAHALAHALK
IIRKTPKKKQILIVNLSGRGDKDIITVNNALLNKEICK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaattacattcctactttggagaatttggaggtatgtatgtacctcaaatt
ttaattccagctttaattcaattagaaaaagaattcatagaagctatgaaagatataagt
tttcaaacaacatttaaaaatcttttacaccattatgctggacgtcctaccccattaacc
ttatgtcaaaatttaacatctggaacatgtagtaaattatatttaaaacgagaagattta
ttacatggtggatcccataaaactaatcaagtattaggacaagccttattagcaaaacgt
atgcataaaaaagaaattattgctgaaacaggagctggtcaacatggagtagctgtttcc
attgcttcatcgctattaaaattaaaatgccgtatttatatgggttataaagatatgaaa
cgtcaagaactcaatgtcttacgaatgaaattaatgggaactcaagtcataccagtccat
catggatctgctactttaaaagatgcttgtaatgaagcaatacgagaatggtcaagcacc
tataaacatacacattacatgataggaacagtagctggccctcatccatttcctacaata
gttaaagaatttcaacgtattataggatcagaaacctataatcaaattcaaacacatgaa
aaaaagttaccagacgctgtgattgcttgtataggtggaggatctaatgcaattggcata
ttttctggttttatagatattccatcggtacaattattaggagtagaagcaggaggatta
ggtttacacacagaatatcatggatcttccttacaatgtggagaaacaggtatttatttt
ggaatgaaatctcctattttgcaatctcaagaaggtcaaattaaaaattcttattctatt
gctgctggattagattttccttccgttggaccagagcatgcttatctaaaaaaaattaat
cgagtgaaatatgtatccatcaatgatgaagaagcaataaatgcttttcaagaattatct
ttatatgaaggaattattcctgctctggaatctgcacatgcgttagcacatgcgctaaaa
atcattcgaaaaacaccaaaaaaaaaacaaattttgatagttaatttatcaggacgagga
gataaagatataattacagtgaataatgctttattaaataaagagatatgtaaatga

DBGET integrated database retrieval system