KEGG   Candidatus Blochmannia floridanus (Camponotus floridanus): Bfl431Help
Entry
Bfl431            CDS       T00138                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bfl  Candidatus Blochmannia floridanus (Camponotus floridanus)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bfl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bfl431 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bfl431 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bfl431 (trpA)
Enzymes [BR:bfl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bfl431 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
471317..472132
Genome map
AA seq 271 aa AA seqDB search
MNRYQTMFKSLNQNKLGAFVPFITIGDPDPTTFIHIIDTLIQSGADALELGIPFSDPVSD
GPSIQKSMERSFKSGANISSCLQLIKKIRNKYPTLPIGLLIYANLIFKNGIKNFYAHCST
LSIDSILIPDLPIEESSLFYNSAMYYQIAHIFICPTNASLDLIKKITDKGIGYIYLLSRS
GITGINNTEFNKIKLNTLIYNIKQCNQKLPILQGFGIYSSEQARSSLLSGTSGIISGSCI
ANIIEENHPNIDLLLEKIRKFTHLMKIAMKL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttatcaaacaatgtttaaatctttaaatcaaaataagctaggagcttttgta
ccttttattacaataggagatcctgatcctactacttttatacatattatagatacatta
atccaatctggtgctgatgctttagaactaggtattcctttttctgatccagtatccgac
ggcccttcaatacaaaaaagcatggaacgttcttttaaatcaggagcaaatatatcaagt
tgcttacaattaattaaaaaaattagaaataaataccctaccttacctataggattatta
atttacgcgaatttaatttttaaaaatggaataaaaaatttttatgctcattgctctaca
ttaagtatagattcgatactcattcctgatttacctattgaagaaagtagtctattttat
aattctgctatgtattatcaaatagcgcatatttttatttgtccaactaatgcatcttta
gatcttataaaaaaaattaccgataaaggtattggatatatttatctattatctagatca
ggtatcactggtataaacaatactgaattcaataaaattaaattaaacacattaatttac
aatattaaacaatgtaaccaaaaattgccaatattacaaggatttggaatatattcttca
gaacaagcacgtagttcgttactatcaggaacatctggaattatatcaggatcctgtatc
gcaaatattatagaagaaaatcatcctaacatagatctattactagaaaaaatacgaaaa
tttacacatttaatgaaaatagctatgaaactgtaa

DBGET integrated database retrieval system