KEGG   Candidatus Blochmannia floridanus (Camponotus floridanus): Bfl431Help
Entry
Bfl431            CDS       T00138                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bfl  Candidatus Blochmannia floridanus (Camponotus floridanus)
Pathway
bfl00260  Glycine, serine and threonine metabolism
bfl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bfl01100  Metabolic pathways
bfl01110  Biosynthesis of secondary metabolites
bfl01130  Biosynthesis of antibiotics
bfl01230  Biosynthesis of amino acids
Module
bfl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bfl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bfl431 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bfl431 (trpA)
Enzymes [BR:bfl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bfl431 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Corona_NS3b
Motif
Other DBs
NCBI-ProteinID: CAD83493
UniProt: Q7VQZ9
Position
471317..472132
Genome map
AA seq 271 aa AA seqDB search
MNRYQTMFKSLNQNKLGAFVPFITIGDPDPTTFIHIIDTLIQSGADALELGIPFSDPVSD
GPSIQKSMERSFKSGANISSCLQLIKKIRNKYPTLPIGLLIYANLIFKNGIKNFYAHCST
LSIDSILIPDLPIEESSLFYNSAMYYQIAHIFICPTNASLDLIKKITDKGIGYIYLLSRS
GITGINNTEFNKIKLNTLIYNIKQCNQKLPILQGFGIYSSEQARSSLLSGTSGIISGSCI
ANIIEENHPNIDLLLEKIRKFTHLMKIAMKL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgttatcaaacaatgtttaaatctttaaatcaaaataagctaggagcttttgta
ccttttattacaataggagatcctgatcctactacttttatacatattatagatacatta
atccaatctggtgctgatgctttagaactaggtattcctttttctgatccagtatccgac
ggcccttcaatacaaaaaagcatggaacgttcttttaaatcaggagcaaatatatcaagt
tgcttacaattaattaaaaaaattagaaataaataccctaccttacctataggattatta
atttacgcgaatttaatttttaaaaatggaataaaaaatttttatgctcattgctctaca
ttaagtatagattcgatactcattcctgatttacctattgaagaaagtagtctattttat
aattctgctatgtattatcaaatagcgcatatttttatttgtccaactaatgcatcttta
gatcttataaaaaaaattaccgataaaggtattggatatatttatctattatctagatca
ggtatcactggtataaacaatactgaattcaataaaattaaattaaacacattaatttac
aatattaaacaatgtaaccaaaaattgccaatattacaaggatttggaatatattcttca
gaacaagcacgtagttcgttactatcaggaacatctggaattatatcaggatcctgtatc
gcaaatattatagaagaaaatcatcctaacatagatctattactagaaaaaatacgaaaa
tttacacatttaatgaaaatagctatgaaactgtaa

DBGET integrated database retrieval system