KEGG   Candidatus Blochmannia floridanus: Bfl463Help
Entry
Bfl463            CDS       T00138                                 

Gene name
hisD
Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bfl  Candidatus Blochmannia floridanus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bfl01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bfl00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
510764..512077
Genome map
AA seq 437 aa AA seqDB search
MISTQYLIPTYWHRCSISEQLTLLTRPINKHNNSIHLDVKYILDHVSKLGDNALIKFNLQ
FDYVNTISLKISPNKIINSGNSLSKPIKKAIHSAIDNITRFHTAQYFPKVDLEIIPGVRC
KQIIRPLHTIGLYVPGGSTPLPSTVMMLGIPAKIAQCKRIILCSPPPIPNIILYTAQLCG
IEEIYQVGGAQAIAAMGFGTESIPRVDKIFGPGNIWVTEAKRQIHYITNKVAIDMLAGPS
EILIIADKTANPIFIAADLLSQAEHGPDSHIILITPDMNLAQQTRQELYKQIQNLDRIDI
IHQSLTHARIIITDNIMECFQISNDYAPEHLLIQTQNPENYLKYITNAGSIFLGHWSPES
AGDYASGTNHVLPTYGHATTTSALGVADFQKRILVQELTQHGLLQLSSTIQTLTKIEKLK
AHEYSVIHRINYIKGTT
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgatttctactcaatatcttatacctacttattggcatcgttgttcaatatctgaacaa
ttaactctacttacacgtccaataaataagcataataatagcatacatttagatgttaaa
tacatattggatcacgtttctaaattaggagataatgccttaataaaatttaatctccaa
tttgattacgttaatacaatctctttaaaaatttcacctaacaaaattataaattcagga
aattctctatctaaaccaataaaaaaagcaatacactctgcaattgacaatattactaga
tttcacacagcacaatattttccaaaagtagatttagaaattatacccggagtcagatgt
aaacaaattattcgacctctgcataccatcggattatatgtaccaggtggatctactcca
ttaccctctacagtaatgatgttaggtatccctgcaaaaatagctcaatgtaaaagaatc
atattatgctcccctcctcctattcctaatataatattatataccgcacaactttgtggc
atcgaagaaatttatcaagtaggaggtgctcaagctattgctgctatgggattcggtaca
gaatctattccaagagttgataaaatttttggaccaggtaatatttgggttacagaagct
aaaagacaaattcattatataactaataaagtggctattgatatgttagctggtccttct
gaaatattaattattgcagataaaactgctaatccaatttttattgcagctgacctttta
tcgcaagcagaacacggaccagattcgcatatcatacttataactcctgatatgaacctt
gcacaacaaacacgacaagaactatacaaacaaatacaaaatcttgatcgcattgatata
atacatcaatcattaacacatgctcgtataatcattactgataatatcatggaatgtttt
caaatcagcaatgattatgctccagaacatttacttatacaaactcaaaaccctgaaaat
tatttaaaatatatcaccaatgcgggatcaatatttttaggacattggtctccagaatca
gctggagattatgcaagtggaactaaccatgtattacctacatatggccatgcaactacc
acttccgctttaggagttgcagattttcaaaaacgaattttagtacaagaattaactcaa
catggattattacaattatcttcaacaattcaaacactaactaaaatagaaaaattaaaa
gcacacgaatattctgtaatacatcgcataaattatattaaaggaactacatga

DBGET integrated database retrieval system