KEGG   Candidatus Blochmannia floridanus: Bfl517Help
Entry
Bfl517            CDS       T00138                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bfl  Candidatus Blochmannia floridanus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bfl01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bfl00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
575233..576387
Genome map
AA seq 384 aa AA seqDB search
MINDLITLTQQLIRQPSITPNDCNCQKIITDYLKSLQFNIEPMNSSNTSNIWAYRYGYDQ
KKYTTLLFAGHTDVVPPGDIHNWQYPPFSGTVHNNIIYGRGSSDMKGALAAMLVATKSFI
QKYPKHKNRIAFIITSDEEGSGIHGTKKIIKSLIHRHEHINYCIIGEPSSNNKIGDVIKN
GRRGSCTGKLVIHGSQGHVAYPQFLKNPIHLAIPILSKLLNTMWDQHKSTLFPDTSIQIT
HLHTIPINYSTNNITPEQLILNFNFRFNDQSTMHSIHNNINKILSNYHVTYHLHWESKSE
PYFSAPGKLVNIIIDIIKKYYNITPQLNTTGGTSDGRFIIQTGAEIIELGALNNTIHKVN
ECIDLVDLKSLSHIYFKIMEKILL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgattaatgatttgataacattaactcaacaattaatacgtcaaccatctattactcca
aatgattgtaattgccaaaaaattattactgattacttaaaatcattgcaattcaacata
gaacctatgaattctagtaatacgtctaatatttgggcttaccgttatggatatgatcaa
aaaaaatatacaacattattatttgcgggacatacagatgtagtacctcctggtgatatt
cacaattggcaatatccgcctttttctgggaccgtacataataacataatatatggtcga
ggatcatctgatatgaaaggagcattagctgctatgttagtagccaccaaatcttttatt
caaaaatatccaaaacataaaaatagaatagcatttataattacctctgacgaagaagga
tctggaattcatggcacaaaaaaaatcataaaatccctaattcatagacatgaacacatt
aattattgcataattggggaaccatctagtaacaataaaataggtgatgtaattaaaaat
ggtagaagaggatcttgtacaggtaaattagtaatacatggatcacaaggacatgtagca
tatccacaatttctaaaaaatccaatacatttagcgattccaatattatcgaaattactt
aatactatgtgggatcaacacaaaagtacactctttcctgatacttctattcaaattact
catcttcatactatacctataaattattctacaaataatattacaccagaacaattaata
ttaaactttaattttcgttttaatgaccaatctactatgcacagtattcacaataacata
aataaaatattatctaattatcacgtaacctatcatttacattgggaatcaaaatcagaa
ccatattttagcgctccaggaaaattggttaatattattattgatatcattaaaaaatat
tacaacatcactcctcaattaaacacaactggaggtacttctgatggtcgctttataata
caaacaggagcagaaattatagaattaggagcactcaacaatactattcataaagttaat
gaatgtattgatttagtagatttaaaatcattaagtcatatttattttaaaattatggaa
aaaatattgttatag

DBGET integrated database retrieval system