KEGG   Candidatus Blochmannia floridanus (Camponotus floridanus): Bfl601Help
Entry
Bfl601            CDS       T00138                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bfl  Candidatus Blochmannia floridanus (Camponotus floridanus)
Pathway
bfl00010  Glycolysis / Gluconeogenesis
bfl00051  Fructose and mannose metabolism
bfl00562  Inositol phosphate metabolism
bfl01100  Metabolic pathways
bfl01110  Biosynthesis of secondary metabolites
bfl01120  Microbial metabolism in diverse environments
bfl01130  Biosynthesis of antibiotics
bfl01200  Carbon metabolism
bfl01230  Biosynthesis of amino acids
Module
bfl_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bfl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bfl601 (tpiA)
   00051 Fructose and mannose metabolism
    Bfl601 (tpiA)
   00562 Inositol phosphate metabolism
    Bfl601 (tpiA)
Enzymes [BR:bfl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bfl601 (tpiA)
Exosome [BR:bfl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bfl601 (tpiA)
  Exosomal proteins of bladder cancer cells
   Bfl601 (tpiA)
  Exosomal proteins of melanoma cells
   Bfl601 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CAD83276
UniProt: Q7VRL0
Position
669260..670048
Genome map
AA seq 262 aa AA seqDB search
MKNLSIIANWKLNGNKNTITNSLINLTTQLTNIPQYIKIAIAPPILYIDMVKNHLTSYNN
KTIELCSQNVDIHLSGAFTGDISASMLKDLSVKYVLIGHSERRIYHKENNSLIAQKFSII
KQTELIPILCIGENKEERDSGSTQSICIQQIDSIIKLVGIKAFENTIIAYEPVWAIGSGS
SASPRNVQSIHQFIRNYIAQYDKTIANQISIQYGGSITTDNVLEFITQKDIDGVLVGSAS
LDIRNLIKIINLSSNLIKKTYQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacctatccataattgctaattggaaattaaacggaaacaaaaatacaataaca
aattcattaataaatttaaccactcaattaactaacataccccaatatattaaaatagct
atagcacccccaatattatacattgacatggttaaaaaccatttaacatcatataataat
aaaacaatcgaattatgttctcaaaacgttgacatacacttatctggagcgtttacagga
gatatctcagcatctatgttaaaagacttatctgtaaaatacgtattaataggccattct
gaaagaagaatatatcataaagaaaataactcattaatagcccaaaaattctctataata
aaacaaacagaacttattcctattctatgtatcggagaaaataaagaagaacgagattcc
gggtctacacaatcaatttgtatacaacaaattgattcaattatcaaattagtcggtata
aaagcatttgaaaatacaattattgcctacgaacccgtatgggctattggcagcggatct
agcgcatccccacgtaacgtacaatcaattcatcaatttattcgcaactacatcgctcaa
tatgataaaaccatagctaaccaaatatcaattcaatatggaggatctataaccaccgac
aatgttttagaattcattactcaaaaagatatcgatggagtactagttggctctgcatct
ttagatataagaaatcttataaaaataataaatctatcatcaaatttaatcaaaaaaaca
taccaataa

DBGET integrated database retrieval system