KEGG   Candidatus Blochmannia floridanus (Camponotus floridanus): Bfl601Help
Entry
Bfl601            CDS       T00138                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bfl  Candidatus Blochmannia floridanus (Camponotus floridanus)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:bfl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bfl601 (tpiA)
   01230 Biosynthesis of amino acids
    Bfl601 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bfl601 (tpiA)
   00051 Fructose and mannose metabolism
    Bfl601 (tpiA)
   00562 Inositol phosphate metabolism
    Bfl601 (tpiA)
Enzymes [BR:bfl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bfl601 (tpiA)
Exosome [BR:bfl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bfl601 (tpiA)
  Exosomal proteins of bladder cancer cells
   Bfl601 (tpiA)
  Exosomal proteins of melanoma cells
   Bfl601 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
669260..670048
Genome map
AA seq 262 aa AA seqDB search
MKNLSIIANWKLNGNKNTITNSLINLTTQLTNIPQYIKIAIAPPILYIDMVKNHLTSYNN
KTIELCSQNVDIHLSGAFTGDISASMLKDLSVKYVLIGHSERRIYHKENNSLIAQKFSII
KQTELIPILCIGENKEERDSGSTQSICIQQIDSIIKLVGIKAFENTIIAYEPVWAIGSGS
SASPRNVQSIHQFIRNYIAQYDKTIANQISIQYGGSITTDNVLEFITQKDIDGVLVGSAS
LDIRNLIKIINLSSNLIKKTYQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacctatccataattgctaattggaaattaaacggaaacaaaaatacaataaca
aattcattaataaatttaaccactcaattaactaacataccccaatatattaaaatagct
atagcacccccaatattatacattgacatggttaaaaaccatttaacatcatataataat
aaaacaatcgaattatgttctcaaaacgttgacatacacttatctggagcgtttacagga
gatatctcagcatctatgttaaaagacttatctgtaaaatacgtattaataggccattct
gaaagaagaatatatcataaagaaaataactcattaatagcccaaaaattctctataata
aaacaaacagaacttattcctattctatgtatcggagaaaataaagaagaacgagattcc
gggtctacacaatcaatttgtatacaacaaattgattcaattatcaaattagtcggtata
aaagcatttgaaaatacaattattgcctacgaacccgtatgggctattggcagcggatct
agcgcatccccacgtaacgtacaatcaattcatcaatttattcgcaactacatcgctcaa
tatgataaaaccatagctaaccaaatatcaattcaatatggaggatctataaccaccgac
aatgttttagaattcattactcaaaaagatatcgatggagtactagttggctctgcatct
ttagatataagaaatcttataaaaataataaatctatcatcaaatttaatcaaaaaaaca
taccaataa

DBGET integrated database retrieval system