KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_100379Help
Entry
BRAFLDRAFT_100379 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Exosome [BR:bfo04147]
 Exosomal proteins
  Proteins found in most exosomes
   BRAFLDRAFT_100379
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 138 aa AA seqDB search
MSWQSYIDQSLLGTGQVAKAAIHGMDGSAWATSKGFKVTSDQVLKIVNAFNTGTLAEFYT
SGMYIGTETTESGTEQEIKYKFIKQNGKAFYVKEGDTGACIFKTNTCLIIAVYEDGMQAG
NCNDVVEKLGEYLLECNF
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcagagctacatcgaccaatctttgttgggaaccgggcaggttgcgaaggcc
gccatccacggcatggacgggagcgcatgggcgacgagcaagggcttcaaggtcacttca
gatcaagtactgaaaatagtcaatgccttcaacacgggcaccctagccgaattctacaca
tctggcatgtatataggtacagaaacgactgaaagtggaacagagcaggagatcaaatac
aagtttataaagcagaatggtaaggcattctatgtcaaagaaggcgacacgggagcatgc
atcttcaagacaaacacgtgtttgatcatcgctgtgtatgaagatggcatgcaggcaggc
aactgcaatgatgtagtggaaaaactgggggaatacctcttggagtgcaacttctag

DBGET integrated database retrieval system