KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_101655Help
Entry
BRAFLDRAFT_101655 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  
histone H2B
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Chromosome [BR:bfo03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    BRAFLDRAFT_101655
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   BRAFLDRAFT_101655
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 283 aa AA seqDB search
MSAAASSPKKASKPKKAPAAHPPTTAMITAALESLKDRTGSSLPAIKKYIAANYKFDVEK
KSHFIKRALKVLVEKGTLLQVKGTGASGSFKINVAAKKAAEKAAKKTTKKPVKKPVAKKA
AKPKTTKPKKPKAKKATTPKKSAKKPAAKKSAKKTPTKKPAAKRAATKKTPVKKAAKKTA
PAKKAAKPKKKRETFGVYIYKVLKQVHPDTGVSSKAMGIMNSFVNDIFERIAAEASRLAH
YNKRSTISSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgcagcatcgtcccccaagaaggccagcaagcccaagaaggcccctgcagct
cacccgcccaccaccgccatgatcacggcggctttggaatcactcaaggaccgcacgggt
tcttcgttgccggccatcaagaagtacatcgccgccaactacaagttcgacgtggagaag
aagtcccacttcatcaagcgcgccctgaaagtcttggtggagaagggtaccctgctccag
gtgaaaggaaccggggcgtcgggatccttcaaaatcaacgtggcagccaagaaggccgcc
gagaaggccgccaagaagactaccaagaagccggtcaagaaacccgtggccaagaaggcc
gccaaacccaagaccaccaagcctaaaaagcccaaggctaagaaggccaccacccccaag
aagtctgccaagaagccagcggccaagaagtctgccaagaagactccgacaaagaaaccc
gctgccaagagagctgccactaaaaagactccggtaaagaaggccgccaagaagacggcg
cccgccaagaaggcagcaaagcccaagaagaaaagggaaaccttcggtgtctacatctac
aaggtgctgaagcaggtgcaccccgacaccggtgtctctagcaaggccatgggcatcatg
aactccttcgtcaacgacattttcgagcgcatcgccgccgaggcttctcgtctggctcac
tacaacaagcgctccaccatcagcagccgcgagatccagaccgccgtgcgactcctgcta
cctggcgagctggccaagcacgccgtcagcgagggcaccaaggcagtcaccaagtacacc
agctccaagtag

DBGET integrated database retrieval system