KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_102435Help
Entry
BRAFLDRAFT_102435 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BRAFLDRAFT_102435
Enzymes [BR:bfo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BRAFLDRAFT_102435
Peptidases [BR:bfo01002]
 Cysteine Peptidases
  Family C44
   BRAFLDRAFT_102435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 539 aa AA seqDB search
MCGIWAIFGSDDDVSKQCASALRIGHRGPDCFRLENINHFKNCCFGFHRLAIVGDTYGMQ
PMRVHRYPQIWLCYNGEIYNYRRVAEQFGFNYETDCDGEAIISLYMHGGIEFAAKHLDGV
FAFILLDTQQKRVYLGRDTYGVRPMFRLLKDDGFLAVCSEAKGLMGLSHGHDDHEVNIDP
FPPGHFETYDLSPNGKVTLKECARFHKIGDMPKYDALVKPLGKCETVWTIFYFLSLMKGG
LDSSLISALLLKHAKKSGIIYPVQTYAIGMEGSPDVEAARTVAKYIGSEHHEVSFTPEEG
IQAIEDVIYSLESYDITTIRASVGMYLVSQYIRTKTDSVVIFSGEGSDELAQGYIYFNKA
PSAEEADVESRRLLGDLYMYDVLRGDRTTSAHGLELRVPFLDHMFTGYYLSLPPEVRRSK
DGIEKYTLRKAFDGTGLLPDEILWRPKEAFSDGVSSVKKSWYETLQEYVEEQINDQMMED
APKTFPFNPPRTKEAYYFRQIFEKHFPSKSRWIPYYWMPRWSQTNDPSARTLKHYKDSS
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatatgggcgatattcggcagtgacgatgacgtgtccaagcagtgcgcgagt
gctctccggatcggccaccgcggccccgactgcttccgcctcgagaacatcaaccacttc
aagaactgctgctttggcttccaccgattggccatcgtgggcgacacctacggcatgcag
ccaatgagagtccacagatacccccaaatatggctgtgctacaacggagagatctacaac
tacagacgggtggccgagcagtttgggtttaactacgagactgactgtgacggtgaggcc
atcatcagcctgtacatgcacggtgggattgagttcgctgctaaacacctggatggagtc
ttcgctttcattctgttggacacacagcagaagagggtgtaccttggacgggacacgtac
ggagtccgccccatgtttcgcctgctgaaggacgatggcttcctggctgtctgctcagag
gcgaagggcttgatgggactgagccacggccatgacgaccatgaggtcaacatcgacccc
ttcccgccgggtcacttcgagacctacgacctcagccccaacggcaaggtcaccttgaag
gaatgcgccaggttccacaagatcggagacatgcccaaatatgatgctcttgtcaagcca
ctgggtaagtgtgaaactgtttggacaatattctatttcttgtcactgatgaaaggtggt
cttgactccagcctgatctcagccctgctgctgaaacatgccaagaagtccgggatcatc
taccccgtgcagacgtacgctatcgggatggagggcagtccggacgtggaggctgccagg
acggttgcaaagtacatcggcagtgagcaccacgaggtgtccttcaccccagaggaggga
atccaggccattgaggatgtcatctacagtctggagagttatgacatcacgaccatccgg
gcatctgtaggtatgtacctggtgtcccagtacatccgtaccaagactgactctgttgtc
atattctctggggaggggtctgatgaactggctcaggggtacatctacttcaacaaggct
ccctcagctgaagaggctgacgtggagagtcggcggttgctaggagacctctacatgtac
gatgtcctgaggggagacagaaccacaagtgctcatggtctggagctgcgagtgcccttc
ctggaccacatgttcaccggctactacctgtccctgccgcccgaggtgaggcgctccaag
gacggcatcgagaagtacacccttcggaaggcgtttgacggaaccggcctcctgcccgac
gagatcctgtggcgcccgaaggaggccttcagcgacggcgtgtcgtcggtgaagaagtcc
tggtatgagaccctccaggagtatgtagaagaacagatcaatgaccagatgatggaggac
gcgcccaagacgttccccttcaacccgccgcgcaccaaggaggcgtactacttccgccag
atcttcgagaaacactttcccagcaagtccaggtggatcccttactactggatgcctcgc
tggagccagaccaacgacccctccgcccgcaccctcaagcactacaaggactccagctaa

DBGET integrated database retrieval system