KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_102486Help
Entry
BRAFLDRAFT_102486 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K15293  
protein unc-13
Organism
bfo  Branchiostoma floridae (Florida lancelet)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1144 aa AA seqDB search
MKRQQGIHNAMATRSSLNDEELKQHVYKKTLQALIYPISSTTPHNFEMWTATTPTYCYEC
EGLLWGIARQGVRCTECGVKCHEKCKDLLNADCLQRAAEKASSKHGAEDKTQNIISAMRD
RMKIRERNKPEIFELIKEVFSVDKTSHAGHMKAVKQSVLDGTSKWSAKLAISVVSAQGLC
PKDKTGTSDPYVTVQVGRVKKRTRTVIQDLNPVWDEKFYFECHNSSDRIKVRVWDEDDDF
KSRLKQKLSRESDDFLGQTIIEVRTLSGEMDVWYNLDKRTDRSSVSGAIRLRISVEIKGE
EKVASYYAQYTCLHENLFHYLCEKNGGMYKIPDAKGDDAWKIYFDEPAQEIVDEFAMRYG
IESIYQAMTHFSCLCSKYMCPGVPALMSTLLANINAFYAHTSASTNVSASDRFAASNFGK
ERFVKLLDQLHNSLRIDLSMYRNNFASSNPEKLGDLKSTVDLLTSITFFRMKVQELQSPP
RAGTVVKECVKACLKSTYQYIFDNCYELHEREFAPDKDKDKVPLEERGPSLKSLDFWTKL
INLVVSVIDEDKASYTPVLNQFPSELNVGELSAATMWELFSQDIKFALEEHDQHRLCPVT
DYMNLHFRVKWLYIEYVAKVPPYKGTVPEYPRWFEPFVLLWLTENDKVSLEFLHGALDRD
RKDGFQQSSEHALFSCSVVDVFTQLNQSFDIIKKLECPDPEVTKHYMKRFAATVNTVLLE
YANIVQKEFDQYCAEEKKACVLMNNIQQLRVQLEKVFESMGGDKLDPEAGDILKELQVKL
NNVLDELSQVFANSLEPQIKEAVVSMGNQLSKIKGAGNVSLNQPSARNNVAQEADVVIKP
LMDLLDKNLTLFAKVCEKTVLKRILKELWRIVMNTMEKTVVLPPLTDISGSQLLLSAAKE
LAHFSQFKQDMNQEDAKNLSPRQCAVLDSALDTIKQYFHAGGNGLKKTFLEKSPDLQSLK
YALSLYTQTTDTLIKTFVQTQTQQDQPSVDDPQGEVSIQVDLFTHPGTGEHKVTVKVVAA
NDLKWQTTGMFRPFVEVNLIGPHLSDKRRKHSTKSKSNNWSPKYNETFHFILGNEDDPMP
LNSTYLRDIVEAGSCACWCALGRNVHLDETGWTILRILSQRSNDEVAKEFVKLKSETRSD
MELG
NT seq 3435 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtcaacaaggtatccacaatgccatggcaaccagatcatccctcaatgatgag
gagctgaaacagcacgtgtacaagaagacattgcaggccttgatctaccccatctccagc
accactcctcacaactttgagatgtggacagcgacgactcccacctactgctatgaatgt
gagggtctcctttgggggatcgccaggcaaggggtccgctgtacagagtgtggggttaag
tgccacgagaagtgcaaggaccttctgaacgcagactgcttacaacgagcggcggagaag
gccagctcaaagcacggagcagaggacaaaacacaaaacatcatctcagccatgagagac
aggatgaaaataagggagagaaacaaacctgagatttttgagctgatcaaggaagttttt
agtgtagacaaaacctcccatgcaggacacatgaaggctgtaaagcagagtgttctggat
gggacatccaagtggtcagccaaactagcaatatcagtggtgagtgcccagggcctgtgt
ccaaaagataagactgggaccagtgatccgtatgtgacagtgcaagttggcagagtcaag
aagagaacgagaacagtaatacaggacctgaaccctgtctgggacgagaagttttacttt
gagtgccataattcatctgatagaatcaaagtccgggtatgggacgaagacgatgacttc
aagtccaggttgaagcagaagcttagtagagaatcagatgactttcttggccaaactatt
atagaagttcgaactctcagtggagagatggacgtttggtacaacttagacaagagaaca
gatcgatcttcagtatcaggagcaatcaggttacgtattagtgtggaaatcaagggagag
gagaaagtggcatcttactatgcacagtacacatgcctacatgagaacctcttccactat
ctctgtgaaaagaatggtgggatgtacaagatacctgatgcaaaaggagatgatgcttgg
aagatttattttgatgaacctgcccaggagatagtggacgagttcgccatgagatacggc
atcgagtccatttatcaggcaatgacccatttctcttgcctgtgctccaagtacatgtgc
cctggtgtgccagcactcatgagcacgctacttgccaacataaatgctttctatgcacac
acatctgcctcaaccaatgtgtcagctagtgacaggtttgctgcctccaattttgggaaa
gagagatttgtaaagcttttggaccagttacacaactcgctgagaatagacctttccatg
taccggaataattttgcatcttcaaacccagaaaagttaggagatttgaagtccacagtg
gacctgctcacaagtattactttcttcagaatgaaggtccaagagttgcaaagcccccca
agggcagggacggtagtgaaagagtgtgtgaaagcctgcctgaagtcaacatatcagtac
atctttgacaactgctacgaactccatgagagagaatttgctccagacaaggacaaagac
aaagttccgctggaggagagaggtccgtcgctgaaaagcctggacttctggacaaaactc
atcaaccttgttgtgtctgtgatagacgaagacaaggctagctacacaccagtgctcaac
caattcccatcagagttgaacgttggtgagctgagtgcagcaactatgtgggagctgttc
tctcaggacattaaatttgcacttgaagagcacgatcagcacaggttgtgtccagtgaca
gactacatgaacctacacttcagagtcaagtggctttacattgagtatgtagccaaggtg
cctccttacaagggaactgttccagaatatcccaggtggtttgaaccatttgtgctgctt
tggctgacagagaatgacaaggtgtccctggagttcctgcatggtgcactggacagggac
agaaaggatgggttccaacaaagctcggagcatgcattgttttcctgctccgttgtggat
gtgttcacacaactgaaccaaagttttgatatcatcaaaaagctggaatgtccagaccca
gaggtgaccaagcattacatgaagaggtttgctgctactgtcaacactgtattgctggag
tatgctaacattgtgcagaaggagtttgaccagtactgtgcagaagagaaaaaggcttgt
gtcctgatgaacaacattcagcagctcagagtccagctggagaaagtctttgagtccatg
ggaggtgacaagctggacccggaggcaggagatattctgaaggaactccaggtgaagctc
aacaatgtgctagatgagctgagccaagtgttcgccaacagtcttgagccccagataaag
gaggctgtcgtgagtatgggtaatcagctcagcaagatcaagggagcaggaaacgtttcc
ctcaaccaaccaagcgccaggaacaacgtcgcccaagaagctgatgttgtcatcaaacct
ctcatggacctgttggataaaaatttgacactctttgccaaggtctgtgagaagacagtt
ctgaagagaatcctgaaagagctatggaggatcgtcatgaacactatggagaagactgtc
gttcttccacctctcacagacattagtggttcacagttacttctgtctgcggccaaggaa
cttgctcatttctcgcagttcaagcaggacatgaaccaggaagatgccaagaaccttagc
cccaggcagtgtgctgttctggacagtgctctggacacaattaagcaatattttcacgcc
ggaggaaatggccttaagaagactttcctggagaaatccccagaccttcagtctctgaaa
tacgcactctccctgtacacccagaccacggacactctcatcaagacgtttgtgcagaca
cagactcagcaagaccagccaagtgtagacgatccccagggcgaagtgtcgatccaggtg
gacctgttcacccatccaggaacgggagaacacaaagtcactgtcaaagtcgttgcagcc
aatgacctgaagtggcagacaacaggcatgttcagacccttcgtggaggtgaatctgatc
ggcccgcacctgagtgacaaaaggcggaaacactccactaaatcaaagagcaataactgg
tctccaaaatataacgagacctttcatttcatccttggtaatgaggatgacccgatgcct
ttgaactccacatatttgcgcgatattgttgaagctggcagctgtgcgtgctggtgcgcc
ctgggaaggaacgtgcacctcgacgaaacaggctggacaatattacgcatcctatcacag
aggtccaacgacgaggtggcaaaggagtttgtcaagctcaaatccgagaccagatcagat
atggagctgggttga

DBGET integrated database retrieval system