KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_105744Help
Entry
BRAFLDRAFT_105744 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01359  
proprotein convertase subtilisin/kexin type 1 [EC:3.4.21.93]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.93  proprotein convertase 1
     BRAFLDRAFT_105744
Peptidases [BR:bfo01002]
 Serine Peptidases
  Family S8: subtilisin family
   BRAFLDRAFT_105744
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 730 aa AA seqDB search
MGRFSTWLVLAIVAFFSHGRAEGGEDQPDHFTNTWAVEIYGGPEKADLLAREHGYENLGQ
IGNLEDHYLFRHKDVPHRSRRGAHQHTKRLGDDERHDTRTSTNLPKLDLHVLPVWRKGIT
GKGIVVAVLDDGIEKDHPDLVDNYDPDASFDFNDNDADPQPRYEETNENKHGTRCAGEIA
MAANNSECGVGIAFNARIGGVRMLDGVVTDAVEANSIGFNIQHVDIYSASWGPNDDGKTV
EGPEKLARAAFEKGVREGRRGKGSIFAWASGNGGSNGDNCDCDGYTSSIYTVSISSASQQ
GRSPWYGEKCASTLATAYSSGEYKDQKISSTDLHHECTDSHTGTSAAAPLAAGVLALALE
ANPDLTWRDVQHLIVWTSEYDPLSGNPGWFQNGAGLWVNSRFGFGLLNAEAMVDMAQTWK
TVPEKNTCEVRIENFQPRNLGNGEEITIEMETDGCRGNNHVEALEHVQVKTTIDYTRRGD
LRIVLTSPSGTSTTLLDTRRQDKSQMGFQDWPFMSTHNWGEKPQGKWTLTIEDKSDHAEN
NGVVKDVVLILHGTPEQPAYQSGGRVYTDYNRVQDDRNVEISAAKSAPAPAADAAPARES
EDWIPSSGPFGSAGSVVIAETPEKETDFLVNWQDGMNRYEPDFNPVNSVPFEPAADAGSD
VYMDAEDLRPWEAFKYLHRQMKSPSSPRHPAHAYNKPSSQYIRDPWVSQNALDNEANLVK
YYLQLLGYEP
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgggacgtttttctacctggctggtccttgcgattgtggcgttcttctcccacgggcgt
gcggagggcggagaggaccaacccgaccacttcaccaacacctgggcggtggaaatctac
ggagggcccgagaaagctgacctgttagcccgagagcatggctacgagaacttgggacag
atagggaacctggaggatcactacctcttcagacacaaagacgtgcctcaccggtcccgc
agaggagcgcatcagcacaccaagcggcttggagacgacgaaaggcacgacacaagaact
tcgacaaacctgcccaaactagacctgcacgtacttccggtctggagaaagggcatcacg
ggaaaaggtatcgtcgtcgccgtgttggacgacgggatcgaaaaggaccatccagacctc
gtggacaactatgaccccgatgctagctttgacttcaacgacaacgatgccgacccgcag
ccgagatacgaggaaacgaacgaaaacaagcacgggacccgttgcgcgggggaaatcgcc
atggcagccaacaactctgagtgcggcgtggggatagcttttaatgcaagaataggaggt
gtgcgaatgctggacggagtggtgactgacgctgtggaggctaactccatcggcttcaac
atccagcacgtggacatctacagcgcctcgtggggacccaacgacgacggcaagaccgtg
gaggggccggagaaactggctcgggctgccttcgagaagggagtcagggagggccgtcgc
gggaaggggtccatctttgcctgggcgtccggcaacggcggcagtaacggcgacaactgc
gactgtgacgggtacacaagctctatctacacggtgtccatcagcagcgcgtcccagcag
ggccggtctccctggtacggcgagaagtgcgcctccacactggccaccgcctacagcagc
ggggagtacaaggaccagaaaataagcagcacagacctgcatcacgagtgtacggacagc
cacacgggaacatcggccgcggcaccactggctgctggggtgctggctctggctctggag
gcaaacccggacctgacctggagagacgtgcagcacctgatcgtgtggacctcagagtac
gaccccctctccggcaaccccggctggttccagaacggcgccggtctgtgggtcaactcc
cggttcggcttcgggctgctgaacgccgaggcgatggtggacatggcgcagacgtggaaa
actgtaccggagaagaacacgtgtgaagttaggattgagaacttccagccgaggaatctg
ggaaatggggaggagatcaccatagagatggagactgacggttgccgtggaaacaaccac
gtggaggctctggagcacgtgcaggtcaaaacgacgatcgactacacccgacgtggcgac
ctgaggatagtgctgacgtcaccgtcaggaaccagcaccaccctcctggacacccgccgt
caggacaagtctcagatgggtttccaggactggcccttcatgtccactcacaactgggga
gagaagccgcagggcaagtggacactcaccatagaggacaagtctgaccacgcggaaaac
aacggcgttgtgaaggatgttgtgctgattctgcacggaaccccggaacagccggcctac
cagtccggagggagggtgtacactgactacaaccgcgtgcaggatgacagaaatgtggaa
atatcggccgctaaatccgccccagcccccgctgcggatgccgcccccgcccgggagtca
gaggactggatccccagctctggtcccttcggctctgctgggagcgtggtaatcgcagag
actccagaaaaagagacggacttcttggtgaactggcaggacggaatgaatcgctacgag
cctgacttcaaccccgtcaactcggtcccgttcgaacccgccgctgatgccggatcagac
gtatacatggatgccgaagaccttcgtccttgggaagctttcaagtacctgcatcggcaa
atgaaatcaccgagcagcccacgtcacccagcgcatgcgtacaacaagccatcgtcacag
tacatccgggacccgtgggtatcccagaatgccctggacaacgaggcgaacctggtgaaa
tactacctacagctgctgggctatgaaccatga

DBGET integrated database retrieval system