KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_113534Help
Entry
BRAFLDRAFT_113534 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BRAFLDRAFT_113534
Enzymes [BR:bfo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     BRAFLDRAFT_113534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 281 aa AA seqDB search
MAAVKDIVTLVLDKDHKTTVTVHLHGATVLAWKAQGKELLFVSDRAVYDNKKAIRGGIPL
VFPNFGPWALGPQHGFARISRWKLEQKPEKDDSGAMTAVFTLTDNKDTRKMWDHKFKLTY
TLHLTEKTFKTTLKVDNTGAETFTFTTLLHTYFRTDDITKATVSGLKGLEYEDKVRGDGK
FTEDRELVTVAEEVDRTYASTPNSHIITGVIGGGKVHMEKTNLPDTVVWNPWVDKAKAMG
DFGDDEYPSMLCVEAGHVATPLSLGAGQSFTGSQTLTLMDE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgtgaaagacatcgtaactttggtgctcgacaaagaccacaaaaccacggtt
accgtccacttgcacggtgccaccgtcctggcgtggaaagcacagggcaaggaactcctc
ttcgtcagcgacagggccgtctacgacaacaagaaggccatacgaggcggaattcccctc
gtttttcccaacttcggtccgtgggcgctcggtccacagcatggctttgcgaggatctcg
cggtggaagttggaacagaagccggaaaaggacgactcgggagccatgactgcagtcttc
accctgacggacaacaaggacaccaggaagatgtgggaccacaagttcaagttgacctac
acgctgcacttgaccgagaaaaccttcaaaacgacgctgaaggtggacaacacaggtgcc
gaaactttcactttcaccaccctgttacacacctacttcaggacggacgacattaccaag
gcaacggtttctggactgaagggactggagtatgaggacaaggtacgcggagacggcaag
ttcacagaagaccgtgagctcgtgacagtggcggaagaagttgaccgaacttacgccagc
acacccaacagtcacatcattacaggagttattggtggaggcaaagtccatatggagaag
accaaccttcccgacaccgtggtctggaacccgtgggtcgacaaggccaaggccatgggg
gacttcggagatgacgagtatcccagcatgctttgcgtggaggcgggtcacgtggccacg
cccctgtcgcttggtgctggtcagtccttcaccggcagccagactctgaccttgatggac
gaatag

DBGET integrated database retrieval system