KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_113695Help
Entry
BRAFLDRAFT_113695 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BRAFLDRAFT_113695
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BRAFLDRAFT_113695
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 487 aa AA seqDB search
MKLIIVLSLFVGALAQWDPNNVSGRHTAVHLFEWRWADIAAECERFLGPYGFGAVQVSPA
SENRVSWGRPWWERYQPVSYQLQTRSGSEAEFRDMVKRCNAAGVRIYVDAVFNHMAEGSG
YGTAGSSYNGLDFPGIYSAFDFNDAKCHTASGGIESYNDANQVRNCKLQGMADLNQGSEY
VRGKISEYLNKLIDAGVAGFRVDACKHMWPGDLQAISGRLHDLSTEYFPAGTRPFFVQPI
TSGQYQHLGRVTEFKYSKFIGEVFRKWNNQKLSYFSNWGEGWGMLPSGSSLVFVDNHDNQ
RGHGAGGASIITFRDSKLYKMANAFMLAHPYGNPRVMSSFYFDSHATDQGPPNSNGNTNG
VTINSDGTCGGGWMCEHRWRQIKNMAQFRNVVHGESLQNWWSNGNNQIAFSRGNKGFIVI
NNDGYNMNEWLQTGMPAGDYCDVISGDKHNGHCSGTTITVGGDGRGHFHISSHADDGVIA
IHQGSKL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcatcatcgtcctgtcactgtttgtgggtgctctggcacagtgggacccaaac
aacgtgtccgggcgacacacggccgtgcacctgtttgagtggaggtgggcggacatcgca
gccgagtgcgagcgtttcctggggccctacggcttcggtgcagtgcaggtgtctcctgca
agcgagaaccgtgtgtcctggggccgtccgtggtgggagcgctaccagccggtcagctac
cagctgcagacccgcagtgggagcgaggcggagttcagggacatggtgaagaggtgtaac
gctgcgggcgtcagaatttacgtcgatgctgtgttcaaccatatggcagaggggtcaggg
tatggtacagctgggtccagctacaatgggttggatttcccgggtatctacagtgccttt
gacttcaatgatgccaagtgccacaccgcaagtggaggcattgaaagctacaacgatgcc
aaccaggtccgtaactgcaagctgcaaggaatggcagatcttaaccagggctccgaatac
gtcaggggaaagatctcagagtacctgaataagctcatcgacgccggtgttgccgggttc
cgagtggacgcgtgtaagcacatgtggccgggtgacctgcaggccatctccggcagactg
cacgatctttccacggagtactttcccgcgggtactcgacctttcttcgtccagcccatc
acatcgggccagtaccaacacctcggccgcgtcactgagttcaagtattccaagttcatc
ggagaggtcttcaggaagtggaacaaccagaagctgagctacttctccaactggggcgaa
ggttggggcatgctgccttctgggagttctcttgttttcgtggataaccatgacaaccag
cgtggccacggtgccggcggtgccagcatcattacattcagagactccaaactctacaag
atggccaatgctttcatgttggcccatccttacggcaaccctcgtgtgatgtccagcttc
tatttcgactctcacgccactgaccaaggtcctcccaacagtaacggaaacaccaacggc
gtcaccatcaactctgacggcacctgtggaggtggctggatgtgtgagcacaggtggcgc
cagattaagaacatggcgcagttccgtaacgtggtccacggtgagagtttgcagaactgg
tggagtaacgggaacaaccagatcgccttctcacgtggcaacaagggcttcatcgtcatc
aacaacgatggctataacatgaacgagtggctgcaaacaggtatgccagccggagattac
tgtgatgtcatttccggcgacaagcacaacggccactgctcgggcacgaccattacagta
ggaggggacggacggggacatttccacatctccagccatgctgatgatggtgtcattgcc
atccaccagggttctaagctgtaa

DBGET integrated database retrieval system