KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_114322Help
Entry
BRAFLDRAFT_114322 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    BRAFLDRAFT_114322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 111 aa AA seqDB search
MADAVAKGNPDKGKKVFVQKCAQCHTVEAGGKHKTGPNLNGLFGRKTGQAAGFSYTDANK
NKGITWAEDTLWVYLENPKKYIPGTKMVFAGLKKKGERADLISYLKQSTAS
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgctgttgcgaaaggcaacccagacaagggaaagaaggtgtttgtacagaag
tgcgcccagtgtcatacagtagaggcgggaggcaagcacaagactggacccaacctgaac
ggtctgttcggccgcaagactgggcaggcagcaggcttctcttacaccgacgctaacaaa
aacaagggaattacatgggctgaggacaccctctgggtctacctggagaaccctaagaag
tacatccccggcactaagatggtctttgctggcttgaagaagaagggcgagcgagcagac
ctcatctcctacctgaagcagtccaccgcttcttga

DBGET integrated database retrieval system