KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_114533Help
Entry
BRAFLDRAFT_114533 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00480  Glutathione metabolism
bfo00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BRAFLDRAFT_114533
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BRAFLDRAFT_114533
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BRAFLDRAFT_114533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 7218068
NCBI-ProteinID: XP_002591986
JGI: 114533
UniProt: C3ZHK2
AA seq 134 aa AA seqDB search
MFGDKLAILGFPCNQFGHQENATNEEILNSLKYVRPGNGYEPKFDMFSKVQVNGSDAHPV
FAYLREKLPIPADSENAFLIMNDPKCVIWSPVTRTDIAWNFEKFLIGPDGQPIKRFSRYF
QTIDIKNDIEALLK
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgtttggggacaagctagctatcctggggtttccctgcaaccagttcgggcatcaggaa
aatgccaccaatgaggagatcctgaattccctaaagtacgtccgacctgggaacggttac
gagcccaagttcgacatgttctcgaaggtccaggtcaacgggtccgacgcccaccctgtc
ttcgcctacctacgagagaagctgcccatccctgctgactccgagaatgcgttcctgatc
atgaatgatccgaagtgcgtcatctggagtccggtcacgcgtacagacatcgcctggaat
ttcgagaagttcctgattggtccagacgggcagccaatcaagcgattcagccgctacttc
cagaccatcgacatcaagaatgatatagaagcgctgctgaagtag

DBGET integrated database retrieval system