KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_114712Help
Entry
BRAFLDRAFT_114712 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K17813  
cytochrome P450, family 1, subfamily D
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Cytochrome P450 [BR:bfo00199]
 Cytochrome P450, animal type
  CYP1 family
   BRAFLDRAFT_114712
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 503 aa AA seqDB search
MAAVATAALFGLSYLQVVLIAVLLVLVAAVVASSLRQNTPSLPPGPWGFPVVGIFPALGS
RPHHAFSRMAEKYGDVFRVKFGSRTVIILNGIDMVKDAFVKQSACFAGRPALYSFKQVKN
GITFKTYSPSWVARKKVTVGALKGFVNGRVGALTASAETMITEEAQELARVFLSKSGQPS
NPEEYAHTAVANVVCALCFGKRYEHGDQEFRQLLRNTEKFRQAIGAGNPADFMPWLRFFP
NKNMKLFKEAMESSTQLFDKHINAHLQTYDPSVIRDIADALIYNMRENKEAGLTDEFVLE
CVIDIFGAGQDTTSQMLHWAFLYMLVFPDVQARVQREIDGVVGRERAPTLADEASLPYTV
AVIQEIVRHTGVVPMSIPHLTTKDTQLHGYTLPKDTIVFANLFSVGHDRRIWGDPSSFRP
ERFLDPSGTTLDPAAVEKNLPFSAGKRRCPGEHLAKQEMFLFFSILLQQCSFERVNGTAS
PTLEGTFGLVMRPQPYSMIVRPR
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggtagccacagcggccttgttcgggctttcttatttacaagttgtcttgatt
gcggtgctgctcgttctcgtggccgcggtggtggcgagcagtcttcggcagaacacgcca
tctctcccgcccggaccctggggttttcccgtggtcgggatcttcccggctctgggtagc
cggccgcatcatgccttctcgaggatggccgagaagtacggagacgtctttcgcgtcaag
tttgggagccggactgttataatactcaacggcatagacatggtgaaggacgcgtttgtc
aagcagtccgcctgctttgccggaagaccggcgctgtactccttcaaacaagtgaaaaac
ggcatcaccttcaaaacgtacagtccatcttgggtggcacggaagaaagtcacggtcgga
gctctaaagggtttcgtcaacggtcgagtcggagcgctcacggcgtcggcagagactatg
atcaccgaggaggcacaagaacttgcccgggtgttcttgtcgaagagcgggcagccgagt
aacccggaggagtacgcacacaccgccgtagctaacgtcgtgtgcgcgctgtgcttcggc
aagcggtacgagcacggcgaccaagagttccgccaacttctgcggaacacggaaaagttc
cggcaggccatcggggcgggtaaccccgccgacttcatgccctggcttcgcttcttcccc
aacaagaacatgaaactgttcaaggaggccatggagtcgtcgacgcagcttttcgacaag
cacatcaacgctcatctccagacgtacgatccctcggtgatcagagacatcgccgacgcg
ctgatctacaacatgcgggagaacaaggaggctggattgaccgacgaattcgtcctggag
tgtgtcatcgacatctttggcgcaggacaggacactacatcccagatgttgcactgggcc
ttcctctacatgctagttttcccggacgtacaggctcgagtccagcgggagatcgacgga
gtggtcggacgggagagggcgccgaccctcgccgacgaggcgagcttgccctacacggtg
gcggtgattcaagagatcgttcgtcacaccggagtcgtccccatgtcgatcccccacctc
accaccaaggatacacagcttcacggctacaccctaccgaaggataccatcgtgttcgcg
aacctgttttccgtcgggcacgatcgcaggatctggggggacccgagcagcttccgtccc
gagcgtttcctggacccgagcggtacaaccctcgaccccgccgccgtcgagaagaacctt
ccgttctccgcagggaaacgtcgctgtcccggagaacacctcgccaagcaggagatgttc
ctcttcttctccatcctcctccaacagtgtagcttcgagcgagtcaacggtacggcgtca
ccaaccttggaaggtacgttcggactagtcatgcggccacagccctacagtatgatcgta
cgtccgaggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system