KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_115498Help
Entry
BRAFLDRAFT_115498 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K05855  
spleen tyrosine kinase [EC:2.7.10.2]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     BRAFLDRAFT_115498
Protein kinases [BR:bfo01001]
 Tyrosine protein kinases
  Syk family
   BRAFLDRAFT_115498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 310 aa AA seqDB search
MAQPGMSLNSSAITNSIWDESDPADQLPPVPQNWVYKKDTPPMEAMGWESPYSDVTLREG
RKLELDPSRLQLKEKLGAGNFGSVLSGTYQLGRKTIEVAVKTLKTEQVPNEEPEILKEAN
MMKDLDHPHIVRMIGVCHGETIMLVLELAPLGPLNKYLKKNASVRPERIVDLMTQVAEGM
AYLESKNFVHRDLAARNILLVSELFAKISDFGMSKALGLGSDYYKTDTAGKWPLKWYAPE
CIYYYKFSSKADVWSYGVTLWEAFSNGRKPYAGMKGQDILTWIESDRRLDRPPTCSEEVY
AVMRSCWQYK
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggcccagcctggaatgtctttgaacagctctgccatcactaactccatctgggatgag
agtgacccagcggaccagctccccccagtgccacagaactgggtgtacaagaaggacacc
ccccctatggaagccatgggctgggagagtccctacagtgatgtcacactacgggagggg
aggaaactggagttagacccctcacggctacagctcaaagagaaactgggtgctgggaac
tttggctcagtactgagtgggacgtaccagctggggaggaagaccatagaggtggccgtc
aagacgctgaagacagaacaagtacccaacgaggagcctgagattctgaaggaagccaac
atgatgaaggaccttgaccacccccacatcgtgcggatgattggcgtgtgccacggggag
accatcatgctcgtgttggagctggctccacttgggccgctcaacaagtacctgaagaag
aacgcctctgtgcgtccggagagaatagtggacctgatgacgcaggtggctgaggggatg
gcgtacttggagagtaagaactttgtccatcgtgacctcgctgcccgtaacatcctgctg
gtcagcgaactctttgccaagatctccgactttggcatgtccaaggcccttggacttgga
agtgactactacaagacggacactgccggcaagtggcctctgaagtggtacgccccagag
tgcatctactactacaagttcagcagtaaagcagacgtgtggagctatggggtgacactg
tgggaggcctttagtaatggcaggaagccctatgctggcatgaaggggcaggacatcctg
acatggatcgagagtgaccggcgtctggaccgccctcccacctgttccgaggaggtgtac
gctgtcatgaggtcctgctggcagtacaagtaa

DBGET integrated database retrieval system