KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_117250Help
Entry
BRAFLDRAFT_117250 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K16174  small subunit ribosomal protein S18b, mitochondrial
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Ribosome [BR:bfo03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    BRAFLDRAFT_117250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_S18
Motif
Other DBs
NCBI-GeneID: 7207896
NCBI-ProteinID: XP_002593706
JGI: 117250
UniProt: C3ZCL3
AA seq 201 aa AA seqDB search
MAGRVGQARRVGASRRRRGLQDSIDTCRLRTASGRRLVRPCSSATTSVGGWVHWKMRSGG
RLGKRTAWRHIGRAGSVAVAGRLAKLTAWWRVGARSVGDVAQWRVGHHSTGGVRSGGWWS
RSPGEAGGMNVELLQHFICPHTGEMHNVLRTGVCQKKHRLLIKEIEKAKDHGLLSFTVPH
KEYDYEEYNRKHPATATVKTG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcgggccgggtcgggcaggcgcggcgggtcggggcgagcagacggcggcgaggtctg
caggacagcattgacacgtgtcggctgcggacggcttcagggcggcgtctggtccggccc
tgttcttcggcgacaacgagcgtaggcggctgggtacattggaagatgaggtctggaggc
aggctgggtaagagaacggcatggagacacattggacgagctggatctgttgcggtagca
ggcaggctggcgaaactgacggcgtggtggcgcgtcggggcgaggtcggtcggcgacgtg
gcacagtggcgggtcgggcatcatagcacgggcggcgttcgctcgggcggctggtggtct
cggtccccgggcgaggcgggcggcatgaatgttgagcttctacagcactttatctgtcct
cacactggagaaatgcacaatgtgctgagaacgggtgtttgccagaagaaacacaggctg
ttgattaaagaaatcgaaaaggcaaaagaccatggtctcttgtccttcacagtgccacac
aaggagtatgattacgaggaatacaacaggaaacatcctgctactgctactgtaaagaca
ggctag

DBGET integrated database retrieval system