KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_117250Help
Entry
BRAFLDRAFT_117250 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Ribosome [BR:bfo03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    BRAFLDRAFT_117250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 201 aa AA seqDB search
MAGRVGQARRVGASRRRRGLQDSIDTCRLRTASGRRLVRPCSSATTSVGGWVHWKMRSGG
RLGKRTAWRHIGRAGSVAVAGRLAKLTAWWRVGARSVGDVAQWRVGHHSTGGVRSGGWWS
RSPGEAGGMNVELLQHFICPHTGEMHNVLRTGVCQKKHRLLIKEIEKAKDHGLLSFTVPH
KEYDYEEYNRKHPATATVKTG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcgggccgggtcgggcaggcgcggcgggtcggggcgagcagacggcggcgaggtctg
caggacagcattgacacgtgtcggctgcggacggcttcagggcggcgtctggtccggccc
tgttcttcggcgacaacgagcgtaggcggctgggtacattggaagatgaggtctggaggc
aggctgggtaagagaacggcatggagacacattggacgagctggatctgttgcggtagca
ggcaggctggcgaaactgacggcgtggtggcgcgtcggggcgaggtcggtcggcgacgtg
gcacagtggcgggtcgggcatcatagcacgggcggcgttcgctcgggcggctggtggtct
cggtccccgggcgaggcgggcggcatgaatgttgagcttctacagcactttatctgtcct
cacactggagaaatgcacaatgtgctgagaacgggtgtttgccagaagaaacacaggctg
ttgattaaagaaatcgaaaaggcaaaagaccatggtctcttgtccttcacagtgccacac
aaggagtatgattacgaggaatacaacaggaaacatcctgctactgctactgtaaagaca
ggctag

DBGET integrated database retrieval system