KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_118024Help
Entry
BRAFLDRAFT_118024 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BRAFLDRAFT_118024
Enzymes [BR:bfo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     BRAFLDRAFT_118024
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRAFLDRAFT_118024
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 669 aa AA seqDB search
MATKMDVDEDVGPAPPDLNRLYDLDSYLKPFDKEIKRRYKCFVEVLEHINQHEGGLEKFS
RGYENFGIHVTEDGGLVMREWAPGAVELYLMGDFNGWNKTSHSFEKKPFGKWELVLPPKD
DGSCPLDHLSKYKLVVKDKNGHLLERICPWAKYTIPSNETKIYEAMFWNPPEKYVFQQSR
PAPPRSLRIYESHVGISSWEGKVADYKHFAYNVIPRIKKQGYNCIQMMAIMEHAYYASFG
YQITSFFAASSRYGPPDDLKLLIDTAHKEGITVLLDVVHSHASKNVLDGLNQFDGTNACF
FHAGSRGNHDLWDSRCFDYTNWEVLRFLLSNLRWWMEEYQFDGFRFDGVTSMLYHSHGIA
HGFSGGLGEYFGLPTDSESLTYLTLANHMLHELYPNCITIAEDVSGMPALCRPVSEGGNG
FDYRLGMAIPDKWIKILKEYKDEDWNIGDIVHTLINRRHGEKTIAYAESHDQALVGDKTL
AFWLMDAEMYTNMSCVSEMTVTVDRGLALHKMIRLITHGLGGEGWLNFIGNEFGHPEWLD
FPRVGNNSSFHYARRQWNLVDDDLLRYKFLNNFDRDMNLTENHFGWLADKQAYVSSKHEG
DKVVVFERGGYKIVLDTDDPAYGGHSRLDHTTDFFTEPIEHDKRANSLQVYMPARTGFIL
AKQDDEKET
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgaaaatggatgtggacgaagacgtcggtcccgcgccccctgacctgaaccgg
ctttatgaccttgactcgtacttgaaaccctttgacaaggaaatcaaaagaaggtacaaa
tgctttgtggaagtgctagagcatataaaccaacacgaaggagggctggagaagttcagc
cgtgggtacgagaactttgggatccatgtgacggaggacggagggctggtgatgcgagag
tgggcacctggagcagtagaactctatctcatgggggacttcaatggatggaacaaaaca
tcccactcctttgaaaagaagccctttggaaaatgggaacttgttcttccaccaaaggat
gatgggagttgtcctctagaccatctgtctaagtacaagcttgttgtgaaggacaaaaat
ggtcatctactggagcggatctgtccctgggccaagtacaccattccatctaatgagaca
aagatctacgaggcgatgttttggaacccgccagagaaatacgtgtttcagcagtcccgc
ccagcgcccccccgcagcctgagaatatacgagtctcatgttgggatctcatcatgggag
ggcaaggttgcagactacaagcactttgcgtataacgtcattccaaggatcaagaaacaa
ggttacaactgtatccagatgatggcaataatggagcatgcctactatgccagctttggt
taccagattaccagtttctttgctgcctccagtcgttatggtcctccagacgacctgaaa
cttctcatcgacacggcacacaaggaggggataacagtcctgctggatgtggtccacagc
catgcttccaagaatgttctggatggtctgaaccagtttgatggaaccaacgcctgcttc
ttccacgcaggcagccgaggaaatcatgacttgtgggacagcagatgttttgactacacc
aactgggaagtgcttcgcttcttgttgtccaacctaagatggtggatggaggaataccaa
tttgatgggttccggtttgatggcgttacctccatgttgtaccacagtcacgggatcgcg
cacggcttctctggaggtctgggggaatatttcggcctccctacagactcagaatccctc
acgtacctaacattggccaatcacatgctgcatgagctgtacccaaactgcatcaccata
gcagaggatgtttccgggatgccagctctttgcagacctgtgtcagagggaggaaatggc
tttgactatcgcttggggatggcaattccagataaatggatcaagatcttgaaagagtac
aaggatgaagactggaatataggagacattgttcacaccctgatcaatcgcagacatgga
gagaagacaatagcttatgctgagagccatgaccaggcattggtgggagacaagacactg
gcattctggctcatggatgctgagatgtacaccaacatgtcatgtgtctcagagatgact
gttacagtggatagaggactagccctacataagatgatccgcctcatcacacatggtctt
ggaggcgaggggtggctcaatttcattgggaatgagtttggacaccctgaatggctggac
tttcctcgggtgggaaacaacagcagtttccactacgcccgccggcagtggaacctggtc
gacgacgacctccttcgctacaaattcctcaacaactttgaccgtgacatgaacctgact
gagaaccattttgggtggctggctgataaacaggcttatgtaagcagtaagcatgagggt
gacaaggtggtcgtgtttgagcgaggagggtacaagatagtcctggacactgatgacccg
gcgtatggtggacatagtcgcctggaccacactacggacttcttcacagaacccattgaa
catgacaagagggccaattcattgcaggtgtatatgccagcacgtacaggcttcattctg
gcaaaacaagatgacgaaaaggaaacctaa

DBGET integrated database retrieval system