KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_118361Help
Entry
BRAFLDRAFT_118361 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Ubiquitin mediated proteolysis
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    BRAFLDRAFT_118361
Protein phosphatases and associated proteins [BR:bfo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     BRAFLDRAFT_118361
Ubiquitin system [BR:bfo04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     BRAFLDRAFT_118361
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 854 aa AA seqDB search
MMNDAIAGKADHDIHINSQLEYPDKRVRVQSEHTAAIWHSLNHYAFADAIFLAERLYAEV
GSDEALFLLATCYYRSGKPYRTYMLLQSRGCPTPQCKFLYAKCCIDLEKYAEGESTFMGG
AIGKQRSYEELVTEFGDAGCFSMQLLGKIFAKSERNKRATDCYKQSLKHNPFLWSSYQAL
CDIGEKPDPDEVFQLTNLQNFSSCQSSFPPPTLTPHQGGTSDITPPTQDIAKSPLVKLQT
PTPTSSTSVGVDMSTGSPQPLVQRVRGRAGRSLLGGPASLSPLTPSFGVLPLDTPSPEVF
STGSCTFVTPSPTTVECSHLDARAPSKKVVTRRNYPSQTKPAVFSQTGNSGNVKESNTLN
TPSPSPSGPQVLVQTTAQGVRRSTRLFTASNSVKENNKKPKTRFAAPKAPAKKTKSRTGK
GSSSQPTITEGSEIIKPESTSTTESKPSQLQVTWALNVQKAAAEGLMTLMRDLGHAYLAL
SHYDCRKAVTLFQQLPQHQYNTGWVLSHIGRAYFELAEYHKAKKAFKEVRKLEPHRVEGM
ELYSTALWHLQKDVLLSSLAQELSDMDRDSAQSWCAVGNCFSLQREHDTAIKFFQRAIQV
EPNFAYAYTLLGHEYVLNEELDKAMSCFRNAIRTDPRHYNAWYGVGMIYYKQEKFSLAEI
HFRKALAINPFSSVLLCHIGVVQHALQKSDSALQTLNKAITADPKNPLCKFHKASILFAT
ERYKDALKELEELKQIVPKESLVYFLMGKVYKKLGQTHLALMNFSWAMDLDPKGANNQIK
EAIDKRYLPEDDDTMDTEDDITADDAGEDSVTIMDEQPLDLDLQGDGSPGEVDTSNEADA
EDVQLHAMESDESL
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatgatgcaatagcagggaaagctgatcacgatatacatataaactcacagctg
gagtatccagacaagagagtgagagttcagtcggagcacacggcggccatctggcattcc
ttgaaccactacgcgtttgcagatgccatcttcctcgcagagcgcttgtatgcagaggtt
ggttcagatgaagcactgtttctgttggcgacctgctactaccgatcagggaagccgtac
cgaacatacatgttactccagtcccggggatgccccactccacagtgcaagtttctgtat
gcaaagtgttgcatagatctggaaaaatatgcagagggagagtccactttcatgggaggg
gcgatcggcaagcagcgttcttatgaagaattggtgacggaatttggggacgcaggatgc
ttctccatgcaacttcttgggaagatatttgcgaagagtgagaggaataagagagctacg
gactgttacaaacagagcctgaaacacaaccctttcctgtggtccagctaccaggctctc
tgtgacattggggagaagcctgacccagacgaagtgtttcagctgaccaacctgcagaac
ttcagctcttgccagtcttccttccctccccccaccctcaccccccaccaggggggcacc
tcggacatcaccccacccacacaggacatcgctaagtctccattggtgaagttgcagacc
cccacccctaccagctccacgtctgtgggggtggacatgtcgacgggatccccccagccc
ctggtgcagagagtccgggggagggcggggaggagtctgctcggggggccggcatccctc
agccccctcacacccagttttggagttctgcctttagacacccctagcccagaagtgttc
agtactggttcctgtacctttgtgaccccctctcccaccactgtagagtgttcacatctg
gacgccagggctcccagcaagaaggttgtaacgagaagaaactacccgtcccaaaccaaa
cctgcagtcttcagccagacaggcaacagtggcaatgtgaaggagtccaacaccttaaat
actcccagtcctagtccaagtggtcctcaggttctggtacagacgacggcccaaggtgta
cgccggagcactcgcctcttcactgcctccaactccgtcaaggaaaataacaagaagcca
aaaacaagatttgctgctcccaaagcccctgcaaagaagacgaagagtcgtacagggaag
gggtcatcgtcccagcccaccatcacggaggggtcggagattatcaaaccagaaagcacc
agtaccacggagtccaaacccagccagctgcaggtcacatgggctctcaatgtacagaaa
gctgctgctgagggccttatgacattaatgcgggacctaggtcacgcctatctagcgctg
agccactacgactgtcggaaggcggtgacgttgttccagcagctgccccagcaccagtac
aacacgggctgggtgctgtctcacatcggcagggcatacttcgaactggctgagtaccac
aaggcaaagaaggccttcaaagaggtgcgtaagcttgagccccacagggtggaggggatg
gagctgtactccaccgcgctgtggcacctacagaaggacgtcctgttgtcgtcgctagcg
caggagctgtccgatatggaccgggactctgcacagtcatggtgtgctgtaggaaactgt
ttctccctccaaagagagcatgacacagccatcaagttcttccagagagccatacaagtg
gagcccaactttgcctacgcctacaccctgctgggccatgagtacgtgctgaatgaggaa
ctcgacaaagccatgtcgtgtttcaggaatgctatccgcacagaccccagacactacaat
gcatggtatggagttgggatgatctactacaagcaggagaagttcagtctggcagagatc
cacttcaggaaagctctggccatcaaccccttcagctccgttctactctgtcatatcgga
gtggttcaacatgccctgcagaagtcggacagtgcgctccagaccctgaacaaggccatc
acagctgacccaaagaacccgctctgtaaattccacaaggcttccatcctatttgccaca
gaaagatacaaggacgcattaaaggaactagaagagttgaaacaaattgtacctaaggaa
tccttagtatacttccttatgggcaaggtgtacaagaagctaggacagacccaccttgcc
ctgatgaatttctcctgggcgatggacctggatcccaaaggtgccaacaaccagataaag
gaggcgatagacaagaggtacctgcctgaggatgatgacacaatggatacagaagatgat
atcactgcagacgatgctggggaagattcagtaacaatcatggatgagcagccattagac
ttggacctgcagggggatgggagtccaggggaggtggacacaagtaacgaggcggacgcg
gaagacgtgcagctccacgccatggagagcgacgagagcttgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system