KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_118432Help
Entry
BRAFLDRAFT_118432 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BRAFLDRAFT_118432
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     BRAFLDRAFT_118432
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRAFLDRAFT_118432
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 727 aa AA seqDB search
MFGAPVKFVLSVAVWLSSWTLNCSAQTEEEKQPEYWNNLAWQDIQNVLQLQPRTGVAKNL
VLFLGDGMGVSTVTAGRILKGQLAGRTGEEELLEMDKLPYSALVKTYNVDRQTGDSAGTA
TAYLSGVKANYATVGVDATVAHGDCAASLTAKTTSILEHAHAAGKSVGIVATARVTHATP
AGTYAYAANRAWEHDGKMPSEAKALGCTDIAQQLVEDNPFIKVILGGGRGYFTSTDQTDP
EYPDQTGFRTDGRDLIQEWQDGKQGAAARYVWRKAEFDQVDPAETDFLMGKFDISADSHA
LNDLVAFNDAIAVGKNMLDLDETLITVTADHSHMFGFGGYAPRGTPILGIVPKSDDNIVL
DGMPFTNILYGNGPGGSLGGRQNLTGVDTADKNYRQQAAVPMKYESHGGEDVSVFADGPM
AHLFRGLHEQVYVAHVMKYAACLGEYTRETMFGAPVKFVLVAAWWSAWVLICSAQTEEER
QPDYWNDLAWQDIQDVLQLQPRTGVAKNLVLFLGDGMGVSTVTAGRILKGQLAGRTGEEE
LLEMDKLPYSALVKTYNLDRQTGDSAATATAYLGGVKANYETLGVDGTVAYDDCAASLTG
KVTSVLEHAHAAGKSTGIVVTSRITHATPAASYAYAANRAWEHDGKVPTDAQALGCKDIA
LQLVQDNPFINVILGGGRAYLTTTNQSDPEYPDQTGFRTDGRDLIQEWQDGKQGAAARYV
WRKAEFD
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtttggagctccggtgaagtttgttctcagtgtagcggtgtggttgtcgtcatggact
ctaaactgctctgctcaaaccgaagaggaaaagcagccggaatactggaacaacctggcc
tggcaggacatacagaatgttctccaactccaacccaggacgggcgtggccaagaacctg
gtgctgtttctaggcgacgggatgggcgtgtccactgtgacggcggggaggatcctgaag
ggccagctggcgggaaggacgggggaggaggagcttctggagatggacaaactgccgtac
tcagctctagtcaagacgtacaacgttgaccgtcagacgggggactcagcaggtacggcc
acggcctatctcagcggtgtaaaggcgaactacgcgactgtaggagtggacgcgacggta
gctcatggcgactgtgccgcgagtctcacagcaaaaacgacgtcaatcctcgaacacgcg
cacgctgcaggtaagtccgttggcatcgttgctacggcacgtgtcactcatgccacacct
gcaggaacatatgcctatgctgcaaacagggcgtgggaacatgacggtaagatgccgagc
gaagcaaaagcccttgggtgcaccgatatcgcccaacaacttgtggaagacaacccgttt
ataaaagtcatacttggcggtgggaggggctatttcaccagtacggaccagacggatccg
gaatatccggaccaaacgggtttccggacggacggccgtgatctgatccaggagtggcag
gacgggaaacaaggtgccgccgcgcggtacgtctggaggaaggcggagttcgaccaggtc
gatccggcagaaaccgactttctcatgggtaaatttgatatcagtgctgactcgcatgcg
cttaatgaccttgtagccttcaatgacgccatcgccgtggggaagaacatgcttgacctg
gatgaaaccctgattactgtgacggcagaccactcccatatgtttggtttcggggggtac
gcgcccagaggaacacctattttgggtattgtgcccaaaagtgatgacaatatcgtcctg
gatgggatgcctttcacgaacatcctgtacggaaacggtccgggagggagtctggggggg
agacagaacctcacgggggtcgacacagcggacaaaaattaccgccagcaggcggccgtc
cctatgaagtatgagagtcatggcggggaggacgtgtcagtgttcgctgacggtccgatg
gcgcacctgttccggggactgcacgagcaggtgtacgtggcacacgtcatgaagtacgcc
gcctgtctgggagagtacacgcgggaaaccatgtttggagctccggtgaagttcgtgctt
gtagcggcgtggtggtcggcatgggttctgatctgttcggctcaaaccgaagaagaaagg
caaccggactactggaacgacctggcctggcaggacatacaggatgttctccaactccaa
cccaggacgggcgtggccaagaacctggtgctgtttctaggcgacgggatgggcgtgtcc
actgtgacggcggggaggatcctgaagggccagctggcgggaaggacgggggaggaggag
cttctggagatggacaaactgccgtattcagctctagtcaagacgtataacttagaccgt
cagactggggactccgcggctaccgcaacagcatatctgggtggcgtgaaggcaaactac
gagaccctgggagtggacggcacggtggcctatgacgactgtgccgcgagtctaactgga
aaagtcacgtccgtcctagaacacgcgcacgctgcggggaagtccactggcatcgttgtg
acgtcacgaatcacccacgccactcccgccgcatcttacgcctatgcagcaaacagggcg
tgggaacatgacggaaaagtcccgaccgacgcacaagcccttgggtgcaaagatatcgcc
ctgcaactggtgcaggacaacccgtttataaacgtcatacttggcggtgggagggcctat
ctaaccactaccaaccagtcggatccggaatatccggaccaaactggtttccggacggac
ggccgtgatctgatccaggagtggcaggacgggaaacaaggggccgccgcgcggtacgtc
tggaggaaggcggagttcgactag

DBGET integrated database retrieval system