KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_118903Help
Entry
BRAFLDRAFT_118903 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K04437  
filamin
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 3563 aa AA seqDB search
MHTNERNPADGPEEEDMPATERDLAEDAPWKRIQKNTFTRWCNEHLKKANKNINDLETDL
SDGLRLIALIEVLSHKRIPRYNKRPTFRAMKLENVSAALQFLEDEHIKIVNIDSSDIVNG
KLKLILGLIWTLILHYSISMPMWEGDDEPAVKQTPKEKLLGFVQAKVPDLPVKNFNKDWN
DGKACGALVDACAPGLCPDWEDWNPNDKVKNCEEAMDLADKWLGVPKLLSPEDMASPHVD
DLSVMTYVSQFPQAKLKPGAPLRPKTNPNKVRVFGKGVEATGNQVGSPAPFTIDTFSAGG
GDIKVSVENPRGKQEQFKLEENLNKAKTYTCTYTPTMEGTYVVKVIFAGKEVPKSPFKVG
VAASKSDPSKCSAKGPGLESAGVVANKATYFDIFTAGSVRSPLFPPLEKGPGAGPGAVNV
VIADPDGKTNTVPVEMEQTGDGQFRCTYKPLKMGIHTITVTFDGSNIPKSPFKVNVAMPK
EDPASTTGTLIDFGDDSPTKGSTQKKETPPAFSSPGLLDDGGSLDTKSPSDPLSNQQALK
PDSSQDLLGFDSEEEDEDGCSFKGGMEMPVKVSDQGDGNYACQYRPGKPGVYKVNITFSG
QHIPKSPFTVNVGSEAKPSRIRAYGPGLEGGQVGHPAEFVVETAGEDISGLGFSIEGPSQ
AKIECHDNGDGSCDVVYWPTEAGEYAVHIVTDDEDIANSPYMAQIRPQDKKFTPGQVKAY
GPGLEKTGIVVGRTMEFTVDAKKVPAGQLQIWAYDQEAEKMDVKVRDNGNKTYTCTYTPT
KAIRYTIDISWDQVNIPNSPFRVHVAEGSYPNKVRVYGPGVEKTGLKSGKPTQFTVDCTE
AGSAGKVNRKTLTAFELYKEHFWELVHGKANTELDKAAVAGDVSIGIKCSPGVVGEREAD
IDFDIVKNDNDTFTVSYVPPAAGRYTIMVMFGEQEIPKSPFTIQVESAGDASKVKAEGPG
LEPTGVVSGKPTYFTVNTRGAGEGKLDLDFVGPSRGGGAKDVNIVDNKDETFTVHYTPVA
AGPMNVSVNYAGKPIPKSPFKVNVAPPVDLSKVKVDGLGEKVIVNQEKEFVVHTRGAGGL
GVVEITIVSVTTKKVLKTTRVEKRGDDYICVFTALEVGMYAVNVSYDGLVVDGSPFGFEA
VPGANPGKVKAYGPGLKGGKVNREQTFTIDTREAGQGGLGLTIEGPSESRIECKDRGDGT
CSVSYWPEDVGEYSINVMFADQHIPGSPFPARVVPAHDASKVKAKGPGLSPGNKAGDPCE
FTVDIREAGEAELTIEVITETGERVDVKIEETHEGTFRIKYVPQIAGSYTITIKYGGDPI
PQVPIRITIEQKVDVSGIRCYGPGVEGMFVDAPTEFTIDAKSVSRRGGDNVRCVVQNPSG
AKTEAAVKDNRDGTYTASYTPFEEGRHLIDVLYEELQVPGAPFKVQATEGCDPSKVRAYG
PGLEGGLTDKPQQFTIETKGAGTGGLGLAIEGPSEAKMTCKDNKDGSCTVEYFPTTPGDY
DIHISYGEQPIRGSPFSVLIKDDIDVSKVKAYGPGLEKTGVRAQNMQVFTVDHTKTGSAP
LDVKVTSQMGATVNTEVTDNRDGTHTVKYIPPSEGACKVDVKYDNQSIPQSPFNVRVEPP
YDASKVKATGPGLQQGVPASFPISFTIDCRDAGNADLEVILEDPDGRMKSPEIHDNGDGT
YTITYTPEQSGNYTIEIKYGGEQVPRSPFRITVKPTGDANKCSVTVRISPPGRVGQGQWI
GDGMQPYIQIGEETCVTVNCKTAGKGKVNCTIQDANGEDVDVDVVENDDGTFDIFYTAQQ
QGEYTITIRFGGQHIQGSPYKVQAVDDLAKIPNGTFQQQYMLSEAESQLQTTNERLSSLQ
KEHDDLLDQNSKLHRLYHDKLTEVEQLNSDLVEVRGMAEINSAKLQSNISILNEEVEALK
SKHKIQEGQLRDRESEIEELRRRIRELEAENEALRKKIADLRRELDDQTANMERYQREAR
DANSEVERLEQLLAQRESDIRGLQSDLLSARDEVNITKMKTTEITRAESEQLSSQMKLSN
DLQMALNEKQGRLGAMEAEARKLRSDLEISRRDNEEKFAEINGLKNKTRDMESELSGLNQ
KLYQDKQANRSLQEKLDDLQFEMNRLRRELQEKEGYITSMETKMSNLESSVVGQSSEKDG
KIQEQMEEIRRLRMKIESLNDDMTERERKMLDLAREKEELQGQYEFYFSETSKLQTQVTE
IQTVQTQMGGSTEALEDELESLRRRLKSDNEHANQEAFELHRRITELELERNTATEKLKH
MEVNMSQGSGEVEKLRQQLRRAEQDSSNTELRYNEMHKVNERLRSDMDDILHQRDIAQRL
SKEQEAKLLSLSQRLRHLEEQTRTEILDLQSKLRNLQNEYQLLDRKQQDTLDKLRVAESE
LQTERTARQSGEFSQTTVSKTTVTKTSAAEEMDSKLRGGQPDDDHDGPDGMERVGEEKLG
RKPKGHGKPRRSGSHTSSSSSSSSSSDSEDEGKSSKKKHPKKKDGEKDKDHPKKKKGVNS
DEEEPKKKGVDFGALLADAKYRPDKVERITAVPGDEMMSVPNEAISRPDDENSRPRWQDD
AKAAPGDEPFFASPAEAARQPWGKQGVVPAEEMQSRPDELRARPWRKGVPEDVTMSGPDD
TSAQPRKKWGTPGNPDDDDDIRPYKRGPDKATPGAQEEMMMADEMEAGAPGRMRPVEFVV
PIFIEVLSSGNLTAEVKQPSGRIAQPKFIDNRDGSLTIKYTPTEAGLHELGIKYNGEHIP
GSPIQFHVDEIRPGQVSAFGSGLSHGVAGQQSNFTIVTKDAGAGGLALAVEGPSKAEITC
RDNKDGTCSVSYLPTQPGEYNIIVKFADRHIPGSPFKAKIVGDQRKPQQVAVGAANEVSL
KIAEQDLSLLQASIRSPSGHEEPCLLKRLSNGHIGISFTPREVGEHLVSVKKNGRHVANS
PFKILVGQQEIGDARKVKVKGTGLRESATFDVAEFTVDTREAGYGGLGLSIEGPSKADIN
CRDNEDGTCTVTYRPTEPGNYIINIKFADQHVPGSPFTVKVTGEGAGKHTEKITRKRQAA
SVATVGSTCDLNLKIPETSPFDLSAQVTSPSGRTEDAEIVELENCTYSVRFVPAEMGIHT
VSVRYKGQHVPGSPFQFTVGPLTEGGAGKVQAGGPGLERGEVGQLSEFTIWTREAGAGGL
AIAVEGPAKAEINFEDRKDGSCGVSYMPTDPGEYQVSIKFNDDHIPGSPFSVDVTPPMGD
ARQVSVSSLQETGLKLNQPASFAVQLNGARPGDLQAQVIAPSGAQEECIITDVEEAGQYV
VRFMPRENGVYTVHVTYNGVPIPGSPFRIRAGSTLVEGDAGMVHAYGAGLEGGRTGERCE
FIVNTINAGAGALAITVDGPSKVQLDCVECDEGYKVTYIPRAPGDYNISVKYAGQNPIVG
SPFRARITGPKMAGAVSGVHESCSVVVETVSKSSAQASYAGGVQGVSRLLSDATKVKSQG
MGLKKGFLGQKNSFNVDCGNAGTNMLMVGVHGPRTPCEEVNVKHMGGQKYNVVYTVREKG
DYELIVKWGDQHIPGSPFKVTVT
NT seq 10692 nt NT seq  +upstreamnt  +downstreamnt
atgcatactaacgagcgcaaccccgccgacggaccggaggaagaagacatgccggccacc
gagcgagatctcgccgaggacgcgccatggaagcgcatccagaagaacaccttcacccga
tggtgcaacgagcacctcaagaaggccaacaagaacatcaacgatctcgagacggatttg
agcgacggcttacgactgatcgcgctcatcgaggttttgtcgcacaagagaattccacgc
tacaacaagaggcccacctttcgggccatgaaactagagaacgtctcggcggcactgcag
tttctagaagacgaacacatcaaaattgtcaatatcgattccagtgacatagtgaacggc
aagttaaagctgatcctgggtctaatatggaccctcatcctgcactactccatctccatg
cccatgtgggagggagacgacgagcccgcggtcaaacagacgcccaaggagaaacttctg
ggcttcgtgcaggccaaggtgcccgacctgcccgtcaagaacttcaacaaggactggaac
gacggcaaggcctgcggtgcgctggtggacgcctgcgcccctggcctgtgccctgactgg
gaggactggaaccccaatgataaggtgaagaactgtgaggaggccatggacttggccgac
aagtggctgggagttcccaagctcctgagcccagaggacatggccagcccccatgtggat
gacctcagtgtgatgacctacgtctcacagttcccacaggccaagctcaagcctggtgct
cccctcagacccaagactaaccccaacaaggttcgtgtcttcggcaagggcgtggaagcg
accggaaaccaggtgggcagccccgcccccttcaccatcgacacgttcagcgccggtggc
ggagacatcaaggtttccgtggagaaccctcgcgggaaacaggagcagttcaaactggaa
gagaacctgaacaaggctaagacatacacctgtacctacacacctaccatggagggcacc
tatgtggtgaaagtgatctttgctggcaaggaagtgcccaagagccccttcaaggtgggc
gtggccgcaagcaagagcgaccccagcaagtgctcggccaagggacccgggctcgaatcc
gccggcgtcgtggcgaacaaggcgacgtacttcgacatctttacagcaggctctgttagg
tctcccctcttccctcctctagaaaagggcccaggtgccggacccggcgctgtgaacgtt
gtcatcgccgaccctgacggtaagacgaacacggttcccgtggagatggaacagacgggt
gacggacagttccgttgcacgtacaaaccactgaagatgggcatccacaccatcactgtc
accttcgatggcagcaacattccaaagagccccttcaaggtcaacgtggccatgccgaaa
gaagacccagcctctactacaggaacgcttatagactttggcgacgactcaccaactaaa
gggagtacgcaaaagaaggagactcccccagcgttctcctcgccgggcctcctggacgat
ggtgggagtctcgacactaaatctccctctgatcctctctctaaccaacaagctcttaaa
cctgactctagccaagacctgctcggctttgactctgaagaagaagacgaggatggatgt
tccttcaaaggtggtatggagatgccagtcaaggtgtccgaccagggtgacggtaactac
gcctgtcagtacaggccgggcaagcctggcgtctacaaagtcaacatcaccttcagcgga
cagcacatcccaaagagccccttcaccgtcaatgtcggctccgaggccaagccgtccagg
attcgcgcgtacggtcctggcttggagggcggccaggtcggccaccctgccgagtttgtc
gtagagacggccggggaagatatttcaggtctaggcttttccatcgagggtccgtcgcaa
gccaagatcgaatgtcatgacaatggggatggatcctgcgatgttgtgtactggccaacg
gaagctggagagtacgctgtgcacatcgtgacagatgacgaagacatcgccaacagcccc
tacatggcgcagatcagacctcaagacaagaagttcactcctggacaggtgaaagcatac
ggaccaggactggagaagaccggaatcgtggttggccgcaccatggagttcaccgtggac
gccaagaaggttcccgcgggacagctgcagatctgggcgtacgaccaggaggcggagaag
atggacgtgaaagtgcgcgacaacgggaacaagacgtacacctgcacatacacgccaacc
aaggccatccgctacactatcgacatctcctgggaccaggtcaacattcccaacagcccc
ttcagggtgcatgttgctgagggcagctaccccaacaaggtgcgtgtgtatggccctggt
gtggagaagacaggactgaagtcagggaagccaacacagttcactgtggactgcactgaa
gcaggcagtgcaggcaaggtgaacaggaaaacgctcacagcttttgagttgtacaaagag
catttctgggagctcgttcatggcaaggccaacaccgagttggacaaggcggctgtagct
ggtgacgtcagcattggtatcaagtgctccccaggtgtggttggcgagagggaagccgac
atcgactttgacatcgtgaagaacgacaacgacaccttcacggtgagctacgtccccccc
gcggccgggcgctacaccatcatggtcatgttcggggagcaggagattcccaagagcccc
ttcaccattcaggtggagtcagctggagatgccagcaaggtgaaagctgagggacctggt
ctggaacctacaggtgttgtgtcaggaaagcccacctacttcactgtcaacacacgtgga
gccggggagggcaaactggacttggactttgttggaccatccaggggaggaggagcgaag
gatgtgaacattgtagacaacaaggatgagaccttcaccgtacactacaccccggtggct
gccggccccatgaacgtcagcgtcaactatgccggcaagcccattcccaagagccccttc
aaggtcaatgtggcaccacctgttgacctcagcaaggtcaaggtcgatgggcttggagaa
aaggtgattgtcaaccaggagaaggaattcgttgtgcacacgcgcggcgctggcggccta
ggagtcgtggaaatcaccattgtgtccgttaccacgaagaaggtgttgaagaccactcgc
gttgagaagagaggagacgattacatctgcgtcttcaccgcactagaggtcggcatgtac
gcggtgaatgtctcgtacgatgggttggtggtcgacgggagccccttcggttttgaggcg
gtgcccggagctaaccccggcaaggtcaaggcgtacgggccggggttgaagggcggaaag
gtcaacagggagcagacgttcaccatcgacacgcgtgaggcgggacagggcggactcggc
ctgaccatcgaggggcccagtgagtctcgtattgagtgcaaggaccgcggagacggcacg
tgttccgtgtcctactggcccgaggacgttggagagtacagcattaacgtcatgttcgct
gaccagcacattcccgggtcaccgttccccgctagggtcgttcctgcacacgacgcctcc
aaggtcaaggccaaaggaccagggctgtctcccggcaacaaggccggcgacccctgcgag
ttcaccgtcgacatccgggaggcaggcgaggccgaactcaccatcgaggtcatcacggag
accggggagcgcgtggatgtgaagatcgaggaaacgcacgaaggaacgttccggatcaag
tacgtgccgcagatcgcgggatcctacaccatcaccatcaagtacggaggggaccccatc
ccgcaggtgccgatccgcatcaccatcgaacagaaggtggacgtcagcgggatcaggtgt
tacgggcctggagtcgaaggtatgtttgtggacgccccgacggagttcaccattgatgca
aagtccgtgagcaggaggggaggtgacaacgtacgctgtgtcgtacagaacccgtccgga
gccaagaccgaggccgcggtgaaggacaacagggacggaacctataccgcctcttacaca
ccgtttgaagaaggccgccatctgattgacgtgctgtatgaggaactacaggtgccggga
gcgcccttcaaggtccaggctacggagggctgcgacccgtccaaggtgcgcgcctacggg
cccggactggagggcggactcaccgacaagccccaacagttcaccatcgagactaagggt
gctggtactggtggtctaggtctggccatcgagggcccctcggaggccaagatgacgtgc
aaggacaacaaggacggcagctgcaccgtggagtacttccccaccacccctggggactac
gacatccacatctcctatggagaacagccaatcagaggaagcccattctctgtgctgatc
aaggatgacattgacgtgtccaaggtcaaggcgtacggacccggtctggagaagacgggc
gtccgtgcccagaacatgcaggtcttcactgtggatcacaccaagacaggcagcgcacct
ctggatgtcaaggtcacctctcagatgggtgcaacagtgaacactgaggtcaccgacaac
cgtgacggcacccacacggtcaagtacatcccgcccagcgagggcgcctgcaaggtcgat
gtcaagtacgacaaccagagcatcccacagagtccgtttaacgtccgtgtagagcctccg
tacgatgccagtaaggttaaggcgacaggcccgggcctgcagcagggagtacctgcatcc
ttccccatctccttcactatcgattgccgtgatgctggcaatgctgacctggaagttatc
ctggaggaccccgatggcaggatgaagagcccagagatccacgacaatggagacgggacc
tacaccatcacctacacccccgagcagtccggaaactacaccatcgagatcaagtatggc
ggcgagcaggtcccgcgctctcccttccgcatcaccgtcaaacccaccggagatgccaac
aagtgctccgtcacagtgcgcatcagcccacccgggcgtgttgggcaggggcagtggata
ggtgacggcatgcagccctacatccagatcggagaggagacctgcgtcaccgtcaactgc
aagactgccggcaagggcaaggtcaactgcaccatccaggacgccaacggcgaggatgtg
gacgttgacgtggtcgagaacgacgacggaacgttcgacatcttctacaccgcgcagcaa
cagggagagtacaccatcaccatcaggtttggaggtcaacacatccagggcagcccctat
aaagtacaggccgtggatgacctggccaagatccctaacggaaccttccagcagcagtat
atgctgtcggaagccgagagccagcttcagaccaccaacgaacggctatcgagcctgcag
aaagagcacgacgatctcttagatcagaacagcaaactccaccgcttgtaccacgacaag
ctcacagaggtggaacagctgaattctgatctggtggaggttcgcggaatggctgagatc
aactcggccaagcttcaatccaacatcagtatcctgaacgaagaggtcgaagctctcaag
tccaagcacaagatccaggaggggcagctgagagatcgcgagtcggagatcgaggaactt
cggcgcaggattcgagaactggaagccgagaacgaggcactgaggaagaagatcgcagac
ctgcgacgggaactggatgaccagacggcaaacatggaacgctaccagcgagaagcgagg
gacgcaaactcggaggtggagagacttgagcagctactggcccagagggagtcagacatc
aggggcctgcagtcggatctgctgtcagctcgtgacgaggtcaatatcaccaagatgaag
acaactgagataaccagggccgagagcgaacaactttcctctcagatgaagctcagtaac
gacctacagatggcactgaatgagaaacagggaaggctaggagccatggaagctgaagcg
cgtaaacttcgctccgacctagaaatatcgcggcgggacaatgaagagaaattcgctgaa
atcaacggcctgaagaacaagacgagggatatggagagtgaattgtctggtctgaaccag
aagttgtaccaagacaagcaggccaacaggtcgctacaggagaaactcgatgatctacag
ttcgagatgaaccgccttcgtcgagaactccaggagaaagagggctacatcacctccatg
gagacaaagatgagcaacctagagagctccgtggttggccagagcagcgagaaggacggg
aaaattcaggagcagatggaagagattcgcaggctgaggatgaagatcgaaagtctgaac
gacgacatgacagagcgcgaacgaaagatgctggatctagcgcgggagaaggaggaacta
cagggccagtatgagttctacttctccgaaaccagcaagcttcagacgcaagtgactgag
attcaaaccgttcagacccagatgggaggcagcactgaggcactcgaagatgagctagaa
agtctgaggcgccgactgaaatccgacaacgagcacgccaaccaggaagcatttgagctg
caccgccgcatcaccgagcttgagctcgaacgcaacaccgcgacagagaagctgaagcac
atggaggtcaacatgagccaggggagcggagaggtggagaaacttcgccagcagctccgc
cgcgccgagcaggattccagcaacaccgagctgaggtacaacgagatgcacaaggtgaac
gagaggctgcgaagcgacatggacgacatccttcaccagcgcgacatcgctcagcgcctt
agcaaggaacaggaggccaaactgctgagcctctctcagaggctacggcacttggaggag
caaacgcgcactgagattctcgacctccagtccaagctgcgtaacctacagaacgagtac
cagttgttagataggaagcagcaagacaccctggacaaactgagggtagctgagagcgag
ctacagacggagaggaccgccagacagagcggggagttctcccagacgaccgtcagcaag
acgaccgtcacaaagaccagcgcggctgaagagatggactccaagctgcgaggaggtcag
cctgacgacgaccatgacggtccagatggcatggaaagggtcggggaagaaaaactcgga
cgtaaacccaaggggcatggcaagcctcgaaggtctggttctcacacatccagttcttcc
tcatcatcatcctcatctgactcagaagatgaagggaaaagttccaagaagaagcaccct
aagaagaaggatggagagaaggacaaggatcatccgaagaagaagaagggtgttaactcc
gacgaagaagagcctaagaagaagggagtagacttcggagcgctgctggctgatgccaag
tatcgtcctgacaaggtcgagcgcatcacagcagtaccgggcgatgaaatgatgtcagta
cccaacgaggcgatctcacgtcctgacgatgaaaactctcgaccaaggtggcaggatgac
gcgaaggcagcacctggtgatgagccattcttcgccagccctgcggaagctgcaaggcag
ccgtggggaaagcaaggcgtggtccctgccgaggagatgcagtctcggcctgacgagttg
agggcccggccgtggaggaagggcgtaccagaagacgtgaccatgtcaggccccgacgac
acgagcgcccagccacggaagaagtggggcacgcccggcaatccagatgatgatgacgac
ataaggccgtacaagagggggccagataaggccacacctggggcgcaggaagagatgatg
atggctgatgagatggaggcgggcgctccaggccggatgaggccggtggagtttgtcgta
cccatcttcatcgaggtgctgtcttcaggaaacctgacagccgaggtgaagcagccttcc
ggccgcatcgcccagcccaagttcatcgacaaccgcgacgggtctctgaccatcaagtac
accccgacagaggcagggctgcatgagctcggcatcaagtacaacggagagcatatacca
ggaagccccatccagttccatgttgatgagatcaggccgggacaggtgtcagcgttcggc
tcgggtctgagtcacggtgttgccgggcaacagtccaacttcaccatcgtcactaaggat
gctggagcaggtggcctggccctggctgtggagggtccgtccaaggctgagatcacctgt
cgtgacaacaaggacggcacctgcagcgtgtcctacctgcccacccagcctggcgagtac
aacatcatcgtcaagtttgcagacaggcacatcccgggcagtccattcaaggccaagatc
gttggagaccagcgcaagccccagcaggtggcagttggagcggctaacgaggtttcgctg
aagatcgcggagcaggacctgagtctgctccaggccagcatcaggagcccctcgggacac
gaggagccctgcctactcaagaggctgtccaacggacacataggtatttcgttcacaccc
cgtgaggttggcgaacacctcgtcagcgtgaagaagaatggccgccatgtcgctaacagt
ccgttcaagatcctggttggtcagcaggagatcggagacgccaggaaggtcaaggtgaag
ggcaccggcctgcgtgagtcggccacgttcgatgtggcagagttcaccgtggataccagg
gaagcaggttacggaggcctggggttgtccatcgagggacccagcaaggcagacattaac
tgcagggacaacgaggacggtacctgcactgtcacctacaggccgaccgaacctggcaac
tacatcatcaacatcaagtttgcagatcagcatgtaccagggagtcctttcacagtgaaa
gtgacaggagagggcgccggcaaacacaccgagaagatcacacgaaaacgacaggccgca
tccgtggcaacggtcggcagcacgtgtgacctgaaccttaagataccagaaaccagtccg
ttcgacctgtcggcccaggtgaccagcccgtccgggaggacggaagacgcggagatcgtt
gagctggagaactgcacgtacagcgtacggttcgtaccggccgagatgggcatccacacc
gtcagcgtcaggtacaagggacaacacgtgcctgggagcccgttccagttcacggttggc
ccccttacagagggtggtgctgggaaggtgcaggctggaggacctgggctggagagggga
gaggtcggacagctctctgagtttaccatctggacccgtgaggcgggtgcgggaggcctg
gccatcgctgtggagggtcccgccaaggctgagatcaactttgaggacaggaaggacggg
tcctgcggggtgtcatacatgccaaccgatccaggagagtaccaggtcagcatcaagttt
aacgatgaccacatcccgggcagtcccttcagcgtggacgtgacccctccgatgggcgac
gctcgccaggtcagcgtgtccagcctgcaggagaccggcctcaagctcaaccaaccggct
tccttcgctgtccagctgaacggagcgcggcccggcgacctccaggctcaggtcatcgct
ccatccggggcacaggaggagtgtattattaccgatgtggaggaggcaggtcagtatgtg
gtgaggttcatgccgcgggagaacggcgtctacactgtccacgtgacgtacaacggcgtg
cccatccccggcagcccgttccgtatccgggcggggtcgacgctcgtggagggagacgcg
ggcatggtgcatgcctacggtgctggcttggaggggggaagaacaggagagaggtgtgag
tttatcgtgaacacgatcaacgcgggagcgggggcgctggccatcacggtggacggcccg
tccaaggtgcagctggactgtgtggagtgcgacgagggctacaaggtgacgtacatccca
cgggcgccgggagactacaacatctccgtcaagtacgccggacagaaccccatcgtgggc
agtcccttcagggcaagaatcacaggtccaaagatggcgggcgcggtgtcaggcgtgcac
gagtcgtgctcggtcgtggtggagacggtttccaagtcttcggcacaggcgagctatgcg
ggcggggtgcagggcgtgtccagactgctgtccgatgccaccaaggtcaagtcacagggc
atggggctgaagaagggctttctgggacagaagaacagcttcaacgtcgactgtggcaat
gcaggaacaaacatgctgatggtgggagtacacgggcccaggacgccgtgcgaagaggtc
aacgtgaaacacatgggcggacagaagtacaacgtcgtgtacaccgtacgagaaaagggc
gattacgaactcattgtaaagtggggggatcaacacatccctggcagtccattcaaggtt
acggtaacataa

DBGET integrated database retrieval system