KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_118926Help
Entry
BRAFLDRAFT_118926 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     BRAFLDRAFT_118926
Peptidases [BR:bfo01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   BRAFLDRAFT_118926
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 300 aa AA seqDB search
MSDGGEWCLIESDPGVFTELIKGFGVKGLQVEEIWSLDPENFDKLKPVHGLIFLFKWQQE
EEPSGSVVQDSRLDHIFFAKQVINNACATQAILSVLLNCRHPDIELGETLANFKEFVQHF
DATMKGLSLSNSDVIRNVHNSFARQQMFEFDVKSAGKDDDVYHFVGYIPIDGRLYQDGEI
HFNLMAVVSDRKMTYERQLTDLQAQLAAIQDGSAMETDQSDTIQSEIGKLHMLIGEEEQK
MRRYKTENLRRKHNYLPMIMELLKILAQEGKLVSLVEKAKDKTAELQSKKDAKKTQEAKS
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtcggacggtggcgagtggtgcctgatcgagagtgaccctggcgtgtttactgagctc
attaagggttttggtgtgaagggactacaggtggaggagatctggagtttggatccggag
aactttgacaaactcaagccagtccatgggttgattttcctgtttaagtggcagcaggag
gaagaacccagcggctctgtcgtccaggactccagactcgatcatatcttctttgccaaa
caggtgatcaacaacgcgtgtgcgacccaggccatcctgagtgtgctgctgaactgcaga
caccctgacatcgagctgggagagacactcgcaaacttcaaggagtttgttcagcacttt
gatgcaactatgaagggactgagtctgagtaactctgatgtcatcaggaatgtacacaac
agctttgcaagacagcagatgtttgagtttgacgtgaagtctgcaggtaaagacgatgat
gtttaccacttcgtcggttacatccccatcgatggacggctgtaccaggatggagagatc
cactttaacctgatggcggtggtgtcggacaggaagatgacgtacgagagacaactgacc
gacctccaggcacaactggcagccatacaggatggtagcgccatggagactgaccaatca
gacaccatccaatcagagatcggcaagctgcacatgctcattggagaggaggaacagaag
atgagaagatacaaaacagaaaacctgcgaaggaagcacaactacctccccatgatcatg
gaactactgaagatcctggcacaggaggggaagctggtctcactggtggagaaggcaaag
gataaaaccgcagagcttcagtccaagaaggatgcaaagaaaacgcaagaggcaaaatcc
tag

DBGET integrated database retrieval system