KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_118958Help
Entry
BRAFLDRAFT_118958 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K11832  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.4.19.12]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Fanconi anemia pathway
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Genetic Information Processing
  Replication and repair
   03460 Fanconi anemia pathway
    BRAFLDRAFT_118958
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     BRAFLDRAFT_118958
Peptidases [BR:bfo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   BRAFLDRAFT_118958
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 892 aa AA seqDB search
MGKRLRCRKARRVKKWLRNNVIKPVGKAVRMVFCGCLCLPVEDVDLEDMEWAHALSLEDE
CIHKVVRMVEESRNNITAEGQVEMEAPPRKRSKLSLSRRKDDSSTTSTVAVPSTQQPVYP
LFQMKGSTDEKDENSQVERPLSTSVVCLTGQLQARKQVLAVTSVSQELAQDVSEVQLDMP
TETSLDVSTVMQTYDYSEYVPFVGLVNLTNTCYMNSVLQILIHTPQFAMRMAYLQGDLRD
IYVEAKQHVNIKQKLKFSKPVFGLLNELCRLFRKVGKLKLNYILAPENQNERLAIEPVRT
LDAIGDAHGMFRGSQQHDAQELLRCMLSSLQDANAAILVRQSERREELRVRQEKLAAIMA
KKQCRKQSVKIGNGGSDLQNGHNGAVMVPLKELEPKEPSKVNGLPNGHNSEKGRVSPVGS
VSKTTKKKRLGLGHSKNQIKITRFASPSDPTPHMTVNGHHRHLEASSASNGRVHVTEDEP
AVATKEHLTNGTWDKDVPVAKENGAAVTTKEHLTNGTRDKDIPVNTTLAEQVSCVTLDGN
MADVSDERMDTGPSVNGSASNGHVQVEDVPTSLMDDNALRLTAKDLTALEKEDGINMIED
LFLGQLQYLTTCIECECKTSRTENFMDLSLPIKMNNKEQDLQDATAGTSPDSNPDDKADN
VSLSWSFDTFMAPEKLDNENKYRCEVCGAESEAKRKLYFAKLPKILTIHLIRFEYNPSGY
GMRKISSPIVIPSHLRLDGFCTDTCADRGFRYEIYGMILHEGSSQDSGHYVSYADTSDVP
VVELDKSSQGEREKKLRRAVAQFDYSGNWIKFNDSYVSLVTEEEMGEILYPERTNSFTPY
LLFYKRTDLECPMADMKAKVERNTEETQGSKAESCSKDSPGKEEEKEEDISR
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggggaagcgtttaagatgccgaaaggctagaagagtgaagaaatggctgaggaacaac
gtgataaagcctgttggtaaagctgtgcgaatggtattttgcgggtgtctttgtttaccc
gtggaggacgtcgacttggaggatatggagtgggctcacgcactgagtctggaggacgag
tgtatccacaaagtcgtacgcatggtagaggagagcaggaacaacatcactgcagaagga
caagtggagatggaggcaccaccgaggaagagatccaagttgagtctgtcgaggagaaaa
gatgactcaagtactactagtacagttgccgtcccatcaacccaacagcctgtgtaccca
ctatttcagatgaagggtagtacagatgagaaggatgagaactctcaagtagagagacca
ctgagcactagtgttgtgtgcctgacaggacagctgcaggccaggaaacaagtactagca
gttactagtgttagccaagagttggcccaggatgttagcgaggtccagctggatatgccc
acagagacgtccttagatgtgtccacagttatgcaaacgtatgactactctgagtatgta
ccctttgtgggacttgttaacctcaccaatacgtgttacatgaacagtgttctgcagatt
ttaatccacacccctcaattcgcgatgaggatggcatacctgcagggcgatctacgggac
atttatgtggaagcaaaacaacatgtcaatataaaacaaaagctgaagttctccaagcct
gtgtttgggcttctgaatgagctctgcaggctcttccgtaaggtggggaaactgaagcta
aactacatcctggctccagagaatcaaaacgagcgcttggccatcgagcccgtccgcacg
ttagatgccataggtgatgcccatgggatgttcaggggttcgcagcaacacgacgctcag
gagttgttgcgatgcatgttatcgagtctacaggatgccaacgctgccatcttggtgcgt
cagtccgagagacgggaggagctaagagtccgtcaggagaaactggccgccatcatggca
aagaagcaatgtaggaaacagtcagtgaagataggtaatggaggcagtgatctgcaaaat
ggacacaatggggcagtcatggttcccttgaaagagttggagccaaaggagccatccaag
gtaaacggccttccaaacgggcacaacagtgagaaaggcagggtttcccccgttggaagc
gtatccaagacgacaaaaaagaaacgactgggtttgggtcattcaaagaaccaaatcaag
atcacgagatttgccagcccaagcgacccaaccccccacatgacagtcaacggtcaccac
aggcacctagaggccagcagtgctagcaatgggagagtgcatgtgacagaagatgaacca
gccgtcgccacaaaggagcatctgaccaatggtacatgggacaaggatgttcccgtcgca
aaggaaaatggcgcagccgtcaccacaaaggagcatctgaccaatggtacaagggacaag
gatattccagtcaataccacactcgcggaacaggtctcctgcgtaacactggatggaaat
atggcggatgtcagcgatgaaaggatggatacagggccgtcggtgaatggcagtgccagc
aacggccatgtgcaggtggaggatgtgcccaccagcctcatggatgacaacgctctcagg
ctgacagctaaggatctgacagccctagagaaggaagatggaatcaacatgatagaggac
ttgtttttaggtcaactacagtatcttaccacttgcattgaatgtgagtgtaagacgtct
cgcacagagaactttatggatctcagcctccccataaaaatgaataataaggaacaggac
cttcaggatgcaacggctggcaccagccctgacagtaaccctgatgacaaggccgacaac
gtctccctgtcatggtcgtttgacaccttcatggctccggagaagcttgacaatgaaaac
aagtacagatgtgaggtctgtggggctgagtcagaggctaaaaggaagctgtatttcgcc
aagctgcccaagatcttgacgatccacttgattcggtttgaatacaacccgtctgggtat
ggtatgagaaagatcagcagccctatagtcatcccgtcccacttgcggcttgacggcttc
tgtacagatacatgtgcggacagaggctttaggtatgagatctatgggatgatacttcac
gagggaagttcccaagactctggacattatgtctcgtatgcagacaccagcgacgtcccc
gtcgtggagttagacaagtccagccagggggagagggagaagaagctccgcagagctgtg
gcacagttcgactattcagggaactggataaagttcaatgactcttacgtcagcctggtc
accgaagaagaaatgggggaaatcttatatcctgagaggacgaactcgttcaccccatac
ttattattctataagagaactgatttagagtgtccaatggcagatatgaaagctaaggtg
gaaaggaacacagaggaaacacagggcagcaaagcggagtcttgtagtaaggactctcca
ggtaaagaggaggagaaggaagaggatataagcagatga

DBGET integrated database retrieval system