KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_119087Help
Entry
BRAFLDRAFT_119087 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BRAFLDRAFT_119087
Enzymes [BR:bfo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     BRAFLDRAFT_119087
Glycosyltransferases [BR:bfo01003]
 Polysaccharide
  Storage polysaccharide
   BRAFLDRAFT_119087
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 806 aa AA seqDB search
MDDDYDDFDDNGPMGTRNKWVFEISTEVANKVGGIYTVIRSKAGVTVDELGDHYCLIGPY
NENSARLEVDPMEPTNDIMRRTLANMREKGVKVEYGRWLINAYPRVVLFDVGSVAWKLDG
WRKEFWEVAGIGIPWPDRECNDAVLLGFLVAWFLGEFRAQCDQCVGKQYLVAPFHKWMFR
AQCDQCVGKQYLVAHFHEWMAGVGLVLCRCRNIDVSTIFTTHATLLGRFLCAGNVDFYNN
LDKFDVDQEAGNRGIYHRYCMERSAAHCAHVFATKFQAIHEFQNLHAIAKEKISEFVRGH
FYGHYDFDIDKTIFMFTAGRYEFSNKGVDMFLEALARLNYYLKSSGSQMTVVAFLIFPAK
TNNFNVDSLKGQAVVKQLRETVAEVQNDIGKRIFESCLGVWRQKYLSANQMSLSVTSRVR
AWPKIARAEIGMPAVSADFLIWEARRPNLPPVCTHNMTDDASDPILNHVRRIQLFNNRAD
RVKIVFHPEFLSSTSALLAMDYEQFVRGCHLGVFVSYYEPWGYTPGTCSCRATSSSYAAA
ILACSCRTTNPGGTRQVRVCVVLRAVCTRLPSWRVRVILRALGVHARYVFMSCYEQFVRG
CHLGVFVSYYEPWGYTPAECTVMGIPSITSNLSGFGCFMAEHIADPTSYGIYIVDRRFRN
PEESVQQLAGHMFDFTRQSRRQRIIQRNRTERLSELLDWKSLGLYYRKARQLALFKKYPE
AIRPDSPKTPQFRYPRPASAPPSPGSSRASTPLPSEHEDDDDDGSYDDSDPNFQPIRMVS
RGSEVFEGSYPIIKPIIKKNSNSNGN
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atggatgacgactatgacgacttcgacgacaacgggcccatgggcaccaggaacaaatgg
gtgttcgagatctcaaccgaggtcgctaacaaagtcggagggatttacacggtgatccgc
agcaaggcaggagtgacagttgacgagctcggtgaccactactgcctgattggtccatac
aacgagaactccgcccgcctcgaggtcgaccccatggaacccaccaatgacatcatgcgc
aggaccctggcaaacatgcgcgagaagggggtgaaggtcgagtacggcaggtggctcatc
aatgcctacccacgggtggtgttgtttgacgttggctccgtggcctggaagctggacgga
tggagaaaggaattctgggaggttgctgggatcggaatcccgtggccggaccgagagtgt
aacgacgcagtgctgctgggattcttggtggcgtggttccttggggagttccgtgcccag
tgtgaccagtgcgtaggaaagcagtatcttgtggcacctttccacaagtggatgttccgt
gcccagtgtgaccagtgcgtaggaaagcagtaccttgttgcacacttccatgagtggatg
gcgggcgttgggctggtcctctgccggtgtcggaacatcgacgtgtctacgatcttcacg
acgcacgccacgttgctggggaggttcctttgcgccggtaacgtcgacttctacaacaac
ctggataagtttgatgtggaccaggaggcagggaaccgcggaatctaccaccggtactgc
atggagcgctcggccgcccactgcgcgcacgtgtttgccacgaagttccaggccatccac
gagttccagaatctccacgccatcgctaaggagaagatcagcgagttcgtccgaggacac
ttctacgggcactacgactttgacattgacaagacgatcttcatgttcactgccgggcgc
tacgagttctcaaacaagggtgtggacatgttcctggaagcactggccaggctcaactac
tatctcaagtcctctggaagccagatgacagtcgtagccttcctgatcttcccagccaaa
acaaacaacttcaacgttgactccctcaaggggcaggcggtcgtcaagcagctcagagaa
accgtggcggaggtacagaatgatatcgggaagaggatttttgaatcatgcctgggggtt
tggcgccaaaaatatctgagcgccaatcagatgagcctgagtgtgacgtcacgcgtccga
gcctggccgaagatcgcccgagctgagatcggcatgccggcagtttccgcggatttcctt
atttgggaagcgaggcggccgaacctccctcctgtctgcacacacaacatgacggacgac
gccagcgatcccatactcaatcacgttaggagaatacagctcttcaacaacagggcagac
agggttaagatcgtgttccacccagagttcctgtcgtccaccagcgcgctgcttgccatg
gactacgagcagttcgtacgcggctgccatcttggcgtgtttgtgtcgtactacgagccc
tgggggtacacgccaggtacgtgttcatgtcgtgctacgagcagttcgtacgcggctgcc
atcttggcgtgttcgtgtcgtactacgaaccctgggggtacacgccaggtacgtgtttgt
gtcgtgctacgagcagtttgtacgcggctgccatcttggcgtgttcgtgtcatactacga
gccctgggggtacacgccaggtacgtgttcatgtcgtgctacgagcagttcgtacgcggc
tgccatcttggcgtgttcgtgtcgtattacgaaccctgggggtacacgccagcggagtgc
acggttatgggtatcccgtccatcacctcgaacctgtcgggtttcggctgcttcatggcg
gagcacatcgcggacccgacctcctacgggatctacatcgtggaccggcgcttcaggaac
ccagaggagtccgtgcagcagctggccgggcacatgtttgacttcacacgtcagtcgcgt
cgccagcggatcatccagcggaaccgcacggagcggcttagcgagctcctagactggaag
agccttggactgtactatcggaaggctcgtcagctggctctcttcaagaaatacccagaa
gccatcagaccggacagccccaagactccgcaattccgctacccgcgcccagcgtctgcg
ccgccatcaccgggcagttcccgcgcctccaccccgctcccgtccgaacacgaggacgac
gacgacgacggtagctatgacgacagcgaccccaacttccaaccaatcaggatggtcagc
cgggggtcagaggtcttcgagggaagctaccccatcattaagccaatcatcaagaagaat
tcaaattcgaatgggaattag

DBGET integrated database retrieval system