KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_119272Help
Entry
BRAFLDRAFT_119272 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K05081  
prolactin receptor
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Neuroactive ligand-receptor interaction
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    BRAFLDRAFT_119272
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    BRAFLDRAFT_119272
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 346 aa AA seqDB search
MYTCSYLVTLLLNVAMLCQGANIFRLQHGHSLEEVSSYPTDAFTSATPTVSHWAWQRELV
AAVGSTVLLNCTARDGLAPAGASWQHNGRKLASSRRDSPAAPGAQLRLEDVRVEDSGTYL
CLVDGKVQTQVVLKIGRKPQLPKIVDCISKNADTFRCWWTVEDSDLETHYRLFYTFNDGK
RIRHECPEYEGVDSCFFGYDHAYLHTRYRFEVRATNALGSATSRPYYVDPTTERVKPDPP
RHVHTRLRHNDGTKVKVSWRSPTDIMYLSIQYELQYRSENDQPDDWTVQKTGEQTNFLLL
GLEPNTRHFLRVRCKPVLLGGFWSEFSDVTEVMTGESHDRHRHHLT
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgtacacctgttcttacctggttaccctacttctcaatgtcgccatgctgtgtcaaggc
gccaacatcttcagactacagcacgggcacagtttggaggaggtatcctcatacccaacg
gatgccttcacgtctgccacgcccaccgtgtcgcactgggcctggcaacgggagctggtg
gccgctgtcggctccaccgtcctgctgaactgcaccgcgcgggacgggctcgcaccagcg
ggcgcctcctggcagcacaacgggaggaagctcgcctcctcccgccgggactctcctgca
gctcccggtgcccagctccgactcgaggacgtgagagtggaggactccggtacctacctg
tgtctcgtcgacggcaaggtgcagacacaagtcgtcctgaagatcggacgaaagccgcag
ctgccgaagatcgtggactgcatctctaagaacgcggacacgttccgctgctggtggact
gtggaggactcagacctggagacgcactacagactcttctacaccttcaacgacggaaag
cggatccggcacgagtgcccggagtacgagggtgtggacagctgcttcttcgggtacgac
cacgcctacctgcacactcgctaccggttcgaggtgcgggccaccaacgcgctcggcagc
gccacctcgcggccgtactatgtagatccaaccacggagagagtgaaacccgacccgcct
cgtcacgtgcacacccgtctccgccataatgacgggacaaaggtcaaggtcagctggagg
tcaccaacagacatcatgtacctgagcatacagtacgagctgcagtacagatcagagaac
gaccagcctgacgattggacggtgcagaaaaccggcgagcagaccaacttcctcctcctg
ggtctggagccgaacaccagacacttcctgcgcgtgcgctgtaaacccgtcctgctgggg
ggcttctggagcgagttctctgacgtcacagaggtcatgaccggcgagtcacatgacagg
catcgtcatcatctgacgtag

DBGET integrated database retrieval system