KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_119542Help
Entry
BRAFLDRAFT_119542 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BRAFLDRAFT_119542
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     BRAFLDRAFT_119542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 598 aa AA seqDB search
MTGRGVRLVLLSITLSVAVAQRTVIETTTGKVRGKVLNLYGRQVVAFLGIPYAEPPIGPL
RFKPPQPAKNWTSVFDAFKYGNSCYQIKDTLFPNFTGSEAWNANTPLSEDCLKINVWMPN
PPPADKTVMVWIYGGGFWYGTASLDYYDGKTIAAIENVVVVSMNYRVGSMGFLALGHPDA
PGNMGLMDQNLALQWVQKNIAFFGGDPQKVTILGESAGSVSVGYHLLSMKSRSLFSRAIM
QSGAPNCPWAFITNKEALRRGKAFARAVECPTTVPLAQTIECLRSKPADYIIANEWVTSD
PIFRFPHVPVIDGTFITEDPKTSIRRGNFKKCSLLAGAVKDEGTFFLIYGAPGFSKQTES
LISRSQFLEGVQMSVPETNSFGVDAIAFQYTDWLKENDGVSNRDALDDVVGDHNVICPLN
DFAHAYASFGQAVYKYSFEQRASNLVWPKWMGTPHGYEIEFQFGLPLEPKRNYTRDEANF
SRRMMRNWANFARTGNPNKESFQTYSQELWPRYTVSGRQFITLDINPPKLGQGPRIDECA
LWSEYLPKLTRQTSDISEAERLWKEEFKLWTKQYMEDWKAQYKDYVNYRDEGCPRPSN
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgacaggacggggtgttcgtttggtgctgctgtcaatcactctgagcgtagcggtggct
cagcggactgtcatcgaaacgaccacgggcaaagtgcgggggaaagtgctcaacctgtac
ggaaggcaggtcgtggcgttcttagggattccctacgcggaaccaccgataggaccgctg
aggttcaaacctccacagcctgctaagaactggacttctgtgtttgacgctttcaagtat
ggaaactcctgctaccaaatcaaggacaccctgtttcctaacttcacgggttcagaagcg
tggaacgccaacaccccgctcagtgaagactgtttgaagattaacgtgtggatgcccaac
ccaccacctgccgacaagaccgtcatggtctggatctatggaggcggtttttggtacggc
actgcgtctttggactactacgatggaaagacgattgcagcaatagaaaacgttgtcgtg
gtgtcgatgaattatcgtgtgggatctatggggttcttggcattaggtcaccctgacgca
cctgggaacatgggactcatggaccagaacctcgcattacagtgggttcagaaaaacatc
gccttttttggaggagatcctcagaaggtgaccatcttgggtgagagtgccggtagcgtg
agtgtgggctatcacctgctatccatgaaaagtcgaagccttttctcaagagcaatcatg
cagagcggagccccaaactgtccgtgggcatttataacaaacaaagaggcacttcgaaga
ggaaaggccttcgcacgagcagtggagtgtccaacgacagtccctttggcacagactata
gaatgtctgcgatccaaaccggcggattacatcatcgctaacgaatgggtcacatcagac
cccatcttcaggtttcctcacgtccctgtcattgatggcaccttcatcacagaagaccct
aagacatccataaggaggggaaactttaagaagtgcagcctccttgcaggagccgtcaaa
gacgaggggacgttcttcctcatctacggagcaccagggttttccaagcaaacggaaagt
ttgataagtcgctctcagtttctggagggggtgcagatgtccgtgccagaaacaaactcc
tttggcgtcgacgccatagcctttcagtacaccgattggttgaaggagaacgacggcgtg
agcaaccgagatgccctggatgatgttgttggagatcacaacgtcatctgtccgttaaac
gacttcgcacacgcctacgcgtcattcggacaagccgtgtacaagtacagcttcgagcag
agggcgtctaatctggtctggccgaagtggatgggaacaccgcacgggtacgagatagag
tttcagttcggactgcctctggaacccaagaggaactacacacgtgatgaggctaacttc
agcagaaggatgatgagaaactgggctaactttgcaaggactgggaacccaaacaaggaa
tcatttcagacgtacagccaggagctgtggcccaggtacaccgtgagcgggaggcagttc
ataacattggacatcaacccgccaaaactcgggcaggggcccaggatagacgagtgtgcg
ctgtggtcagagtatctacccaagctcacgcgccaaacaagtgatatctccgaagcggaa
agactgtggaaggaggaatttaagttgtggaccaaacagtacatggaggactggaaagcg
cagtataaagactacgtcaactacagagacgagggctgccctaggccgtcaaattag

DBGET integrated database retrieval system