KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_119617Help
Entry
BRAFLDRAFT_119617 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K15759  inositol monophosphatase 3 [EC:3.1.3.25 3.1.3.7]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00562  Inositol phosphate metabolism
bfo00920  Sulfur metabolism
bfo01100  Metabolic pathways
bfo04070  Phosphatidylinositol signaling system
Module
bfo_M00131  Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BRAFLDRAFT_119617
  Energy metabolism
   00920 Sulfur metabolism
    BRAFLDRAFT_119617
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    BRAFLDRAFT_119617
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     BRAFLDRAFT_119617
    3.1.3.25  inositol-phosphate phosphatase
     BRAFLDRAFT_119617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-GeneID: 7222452
NCBI-ProteinID: XP_002592235
JGI: 119617
UniProt: C3ZGM0
AA seq 357 aa AA seqDB search
MAPMGVRLSPLGYALIFILIGSVVLYLQVWMRGSSDKKNPKLTLGEDGDVRSMSVDISLK
ELLAVSIDLAEKGGDKVREIREANKLAEKSKGETREGANDPMTDGDLQSHIAIVHGFEKV
FPRLKVVSEEHEKKGDETRQVATPKLTHPEVDEVIKADQRVPYEDVTVWVDPLDATQEYT
EDLRQYVTTMVCVAIKGKPTIGVIHKPFEHRTAWAWVGHGHSKGLNVQERKAGEGQAQKI
IVSRSHAGSVEQVAKQMLGDKTEVIPAGGAGYKVLSLFEGIADAYIHVTLIKKWDICAGN
ALLNTVNGHMTTLGGEDINYSAEGNPKNEGGLLATLVDHQKFLEKFAPEAKKLAEKH
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaatgggggtgcgcctgtcccccctggggtatgccctgatattcatactcatc
ggcagtgtggttctgtacctgcaagtgtggatgcggggctcgagcgacaagaagaacccc
aaactgactctgggggaagacggggacgtgcgctccatgagtgtggacataagcttgaag
gagctgctcgcagttagtattgacttagccgagaagggaggggacaaggtgagagagatc
agagaggcaaacaagctggcagagaagagcaagggggagacgagggagggcgcgaacgac
ccgatgacggacggggacctccagtcccacatcgcgatcgtgcacgggttcgagaaggtg
ttcccgcgcctcaaggtggtgtccgaggagcacgagaagaaaggggacgagacacgccag
gtcgcgaccccgaaactgacccaccccgaggtggacgaggtcatcaaggccgaccagagg
gtcccctatgaggatgtgacggtgtgggtggaccctctggatgccacgcaggagtacacg
gaagacctgcggcagtacgtgaccaccatggtgtgcgtggccatcaagggcaagccgacc
atcggcgtgatccacaagccgttcgagcacaggacagcatgggcctgggtggggcacggt
cactccaaggggctcaacgtccaggagagaaaagccggggaggggcaggcacagaagatc
atcgtgtcgcggtcgcacgcaggctcggtagagcaggtagccaagcagatgttgggcgac
aagacggaggtcatacccgcgggcggcgccggctataaggtcctctcgcttttcgagggg
atcgccgacgcgtacatacacgtgaccttgataaagaagtgggacatctgcgcagggaac
gctctactgaacacggtaaacggacacatgacgacgctgggtggggaggatataaactac
tccgccgaggggaaccccaagaacgagggagggctgctagcgaccctcgtcgaccaccag
aagtttctcgagaagttcgcgcccgaagccaagaagctagcagaaaaacactag

DBGET integrated database retrieval system