KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_119977Help
Entry
BRAFLDRAFT_119977 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:bfo00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 177 aa AA seqDB search
MVRAWYMDDSDADQRAPHMTDPPQPVELDQLKNIGVLYWQLSGNEDDETLAGIRKDRGYS
YNDLIEITPEKLPNYEQKIKTFFEEHLHLDEEIRYCVGGSGYFDVRDKGDKWIRIEMEKG
DLIVLPAGIYHRFTLDEKNYIKAMRLFVGEPVWTPYNRPADDKDARKEYLKTMGLAA
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtgcatggtacatggatgactctgacgctgaccagcgcgctccccacatgaca
gacccgccccagccagtggaactggaccagctcaaaaacatcggggttctgtactggcag
ctgtctggaaatgaggatgatgaaactctggctggcatcaggaaggatcgtgggtactcc
tacaacgatctcatcgaaatcaccccagaaaagctgcccaactacgaacagaagatcaag
acgttttttgaggagcacctacatcttgacgaggagatcaggtactgtgttggagggagc
ggttacttcgacgttcgtgacaagggggacaagtggatccgcatcgagatggagaaggga
gacctgatcgtcctccccgccggcatctaccatcgcttcactctggatgagaagaactac
atcaaagcgatgcgtctgtttgttggagagccggtgtggaccccgtacaatcgtcccgct
gacgacaaggatgcccgtaaggagtacctgaagaccatgggcctggctgcttaa

DBGET integrated database retrieval system