KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_120045Help
Entry
BRAFLDRAFT_120045 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    BRAFLDRAFT_120045
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    BRAFLDRAFT_120045
Translation factors [BR:bfo03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    BRAFLDRAFT_120045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 227 aa AA seqDB search
MASAEPAKQPQESPLEAAAVKTEEEKDEAAGAAAAKLDTDDLKYIKHPLQNRWALWFFKN
DKTKTWAANLRCVSTFDTVEDFWALYNHIQVASRLQSGCDYSLFKDGVEPMWEDAFNKTG
GRWLINIQKQQRHSDLDRFWLETLLCLIGEAFEEDSDEVCGAVINVRGKGDKIAIWTHDC
KNSDAVIRIGRKFKERLNLPPKFVIGYQAHTDTMSKSGSTTKNRFSV
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcatctgcggaacccgccaagcaaccacaggagtctcccctggaggcagctgcagtg
aagactgaagaggagaaggatgaggcggctggagcggctgctgccaagctggacacagac
gacctgaagtacatcaaacaccctctccagaacagatgggcactttggttcttcaagaat
gacaagaccaagacttgggctgccaaccttagatgtgtgtccacttttgacacagtggag
gacttctgggccctgtacaatcatatacaagtcgccagcagactgcagtccggctgcgat
tactccctcttcaaggatggagttgaacccatgtgggaggatgccttcaacaagacgggt
gggcgctggctcatcaacattcagaagcaacaacgccactccgatctcgacagattttgg
ctggaaactctgctgtgtttaattggggaggccttcgaggaggattcggacgaagtctgt
ggtgccgtcatcaacgttcgcggcaaaggggacaagattgcaatctggacacatgactgt
aaaaactcagatgctgtcataagaatcggtcgaaagttcaaagagaggctaaatcttcct
cctaagtttgtcatcggttaccaggcacacacagacacaatgtcgaaaagcggctccaca
acaaaaaatcgcttctccgtataa

DBGET integrated database retrieval system