KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_120433Help
Entry
BRAFLDRAFT_120433 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BRAFLDRAFT_120433
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     BRAFLDRAFT_120433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 305 aa AA seqDB search
MALQDFSPFPVLIAAALVAVSAAVVGFLFSGKKKGPPRALQDPTVKYPFKLVDKEIVSHD
TRRFRFALPSPEHVLGLPIGQHIYLSARVNGELVIRPYTPVSSDDDKGYFDLVIKVYFKN
VHPKFPDGGKMSQYLENMQLGDFIDVRGPSGLLVYDGNGQFSIKPDKKSPAAQKTAKNVG
MIAGGTGITPMLQLVREVLKNPDDDTNLYLLFANQTEKDILLRPELEELADQYKDRFKLW
YTLDRPEDGWKYSAGFVDDTMLSEHMPPPGDDTLVLMCGPPPMVKFACLPNLDKLGYTSD
RRFAY
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttcaggatttctctccctttcccgtgcttatagccgcggcgcttgttgccgtg
tcggcggcagtggtcggctttctcttctccggcaagaagaagggcccgccgagggctctg
caggacccgaccgtcaagtatcccttcaagctcgtggacaaggagatcgtgagccacgac
acccggcggttcagattcgccctcccctctcccgaacacgttctaggtctgcccatcggc
cagcacatctacctgagcgcccgggtgaacggcgagctcgtgatccgcccttacacacct
gtctccagcgatgacgacaagggctacttcgaccttgtcatcaaggtgtacttcaagaac
gtgcatcccaagttcccggatggagggaagatgtcgcagtacctggagaacatgcagctg
ggagactttatagatgtgcgcgggccgagcggcctgctggtttacgacggcaacggtcag
ttcagtatcaagcctgacaagaagtcaccggcggcgcagaagacagcaaagaatgtcggg
atgatcgcaggtggcaccggtatcaccccgatgcttcaacttgtccgagaggtgttgaag
aatccagacgatgacaccaacctgtatctgctgttcgccaaccagactgagaaggacatc
ctcctccgaccggagctggaagagctggccgaccagtacaaggacaggttcaagctgtgg
tacaccctggaccgtccggaggatggatggaagtacagcgccggtttcgtggatgacacc
atgctatcggagcacatgccgccacccggtgacgacaccctcgttctgatgtgcggacct
ccgcccatggtcaagttcgcctgcctacctaacctggacaagctaggctacacttctgac
cgacgctttgcttactga

DBGET integrated database retrieval system