KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_121010Help
Entry
BRAFLDRAFT_121010 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     BRAFLDRAFT_121010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 439 aa AA seqDB search
MLDFSVALLTYPSSNAHNKDGGAHQGIGDISSRFLEDRHKGSWLVEFYAPWCGHCKKLEP
VWHHVGRSLQGSPIKVARVDATRYTAIANEFTIRGYPTIKFFKGDQIFTHNGGRSMEDIV
QFAQRAQGPAVRELRSVTQLNDLRIKHSVFFLYVGDDNDSELKTAYSAIAEDYVLKGYFY
QAPPTILPQDIKVDTLPTVLVLKDRKFFKYGGGDKASLKDWIELERFPAFPRISGDNINE
LAGSGRKIAVAVIEDSSVPTDVEEDTRVREMLQELAKGRDTEFHSTFLYGWMDGTELINQ
ITMSFVNTPAIIVLEPSTESYYLPDTPSAGMARPQLKGFLRKVISGDAPAHGGNSILQRL
KRVLYDFITGVTSLFRAQPFIASILLGLPTFVVSFLCYSLCTTEVVDDMEDEDDLSEDEK
EDEDKIDRYEEVSGHMKKE
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgttggatttttcagtggctttgctaacttacccgtcatccaatgcgcacaacaaagat
ggcggcgcccatcagggaattggcgatatttcttctcgctttcttgaggacagacataaa
ggatcttggcttgtggaattctatgcgccatggtgtggacactgtaagaagctggagcca
gtgtggcaccatgtaggccggtccctgcaggggtctcccatcaaggtagcacgggtagac
gccaccagatacacagctattgccaatgagtttacaatcaggggataccccaccatcaag
tttttcaaaggggaccagattttcacccacaatggaggaaggtccatggaagacattgtg
cagtttgctcagagagcacaaggtcctgcagtgagagagctgagaagtgtgacccagctg
aatgatctacgcatcaaacactctgtgttcttcctgtatgtgggagatgacaatgactcg
gagctgaagacagcatacagtgcaatagctgaagattatgtgttgaagggctacttttac
caagctccacccaccattctacctcaggatatcaaagtggacacattaccaacagttctg
gtgttgaaagatcgaaaattcttcaaatatggaggtggtgataaggcctcactcaaagac
tggatagaactggagaggttcccagcattccccaggatatctggtgacaacatcaatgaa
cttgcaggttcaggcagaaagatagcagtggcagtgatagaggacagctcagtcccaaca
gatgttgaagaagacacaagagttagggagatgctgcaggaactggccaagggcagagac
acagagtttcacagtacctttctgtatggctggatggacgggacagaactcatcaaccag
atcaccatgagttttgtcaacaccccagccattattgtcttggagccttccacagaatcc
tactacctaccagacacccccagtgcaggaatggcacggccacaactcaagggcttcctc
agaaaagtcatcagtggtgatgcacctgcacatggtgggaacagtatcttacagagattg
aaacgagtcctctatgacttcatcacaggagtcacgtcgctgttccgagcgcagcctttc
atagccagcatcctgcttggcctgcccaccttcgtggtgtcattcctgtgctattcgctc
tgcaccaccgaggttgtggatgacatggaggatgaagatgacttgtcagaggatgagaaa
gaagatgaggacaagattgacaggtatgaggaggtgtcagggcacatgaagaaagagtga

DBGET integrated database retrieval system