KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_121149Help
Entry
BRAFLDRAFT_121149 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BRAFLDRAFT_121149
   01212 Fatty acid metabolism
    BRAFLDRAFT_121149
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BRAFLDRAFT_121149
   00650 Butanoate metabolism
    BRAFLDRAFT_121149
  Lipid metabolism
   00062 Fatty acid elongation
    BRAFLDRAFT_121149
   00071 Fatty acid degradation
    BRAFLDRAFT_121149
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BRAFLDRAFT_121149
   00310 Lysine degradation
    BRAFLDRAFT_121149
   00380 Tryptophan metabolism
    BRAFLDRAFT_121149
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BRAFLDRAFT_121149
Enzymes [BR:bfo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BRAFLDRAFT_121149
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 295 aa AA seqDB search
MAALRVTVQKLLQARSAVSPLLAVPALSRACHHGHHFEYINVSKAGEKQNVGMIELNRPK
ALNALCDGLMGEVKTALEDFEADKEVGCIVLTGSGQKAFAAGADIKEMSIRKFQEVFGGN
FLSNWSHLADTTKPVIAAVNGYALGGGCEIAMMCDIIYASEKARFGQPEIALGTIPGAGG
TQRLTRAVGKSLAMEMVLTGLPITAQEAQQAGLVSKVFPPDQLVSEAIKAAEKIASHSKL
VVAMAKEAVNASQEMTLREGVHFEKRLFHASFATNDRKEGMAAFVEKRKAEFTDS
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgttacgagtcaccgtgcagaaactcctgcaggccaggtcggcagtttctccc
ctcctcgccgtgccagcactgtctagagcctgtcatcacgggcatcattttgagtacatc
aatgtgagcaaggcgggagagaaacagaacgtcggaatgatcgagttgaaccgacccaag
gcgctgaacgcgctgtgcgacggcttgatgggggaggtcaagactgcacttgaggacttt
gaagcagataaggaagtgggctgtatcgtcctgaccgggtcgggtcagaaggcgttcgcg
gcaggtgccgacatcaaggagatgtctatccgaaagtttcaggaagtcttcggcggtaac
ttcctctccaactggtcccaccttgcggatacgaccaagcccgtcatcgcggctgtgaac
ggctacgcactgggcggcggctgcgagatcgccatgatgtgtgacatcatctacgccagc
gagaaggcgaggttcgggcagccggagatcgccctggggaccatcccgggggcggggggc
acccagaggctgacccgggcggtggggaagtccctcgccatggagatggtactgaccggt
ctccccatcacagcacaggaggctcagcaggccggactggtcagtaaggtcttccctcca
gaccagctggtcagcgaggccatcaaggcggccgagaagatagccagtcattccaagctc
gtagtggccatggctaaggaggcggtcaatgcctcacaagagatgacccttagggagggg
gttcactttgagaagaggctgttccatgcctcctttgctactaatgacagaaaggaaggc
atggcagcttttgtagagaaaaggaaggctgagttcacagatagctaa

DBGET integrated database retrieval system