KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_121378Help
Entry
BRAFLDRAFT_121378 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
Organism
bfo  Branchiostoma floridae (Florida lancelet)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
JGI: 
UniProt: 
AA seq 509 aa AA seqDB search
MQARLTAASTQLNDGGEEAREFPEKDDSKLKSLGNALRTGWSRQSSRTRRSKPPAGVTGL
LPQIVTHGLTDPGRADRRVRINISGMKFDTRERVLLRYPQTLLGDVVRRQRFYVPEEEEY
FFDRHRPSFEGIFRYYQTGKIERPRNVPQDVFAAELAYFDMGKLVINKFLKDEGYDVSEN
VLPEKEPQRTVWILFESHDGILAKFVGLITVLFILLSVGTSCAETLPRFRNLTDQTFAHA
GDVKANLNIAFSNIFFQIETACIVWFCIELAMRFYASPRKRRFVKDIMNILDFVVILPYF
VDLILIVANVDPTGSNIIPATIVRVLRLVRVFRIFKLSRHMRALQMLAATLRASAPQLIM
LVFFMAILVVLYSSIIYFMEMDHPDHFFPSIPAAFWWAIITLTTVGYGDIYPKTPWGKAF
ACICVISGILVIAMPMPIITKNFEKFYKKNGNNPFKALPLNNGHEERDDNSSEHRKRTYA
VRLTDIETEEHESFLKDEDESSSGFLSSV
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcgagactaacagcagcatcaacacagttaaacgacggaggggaggaggcgaga
gaattccccgaaaaagacgactcaaagttgaagtccctgggtaacgccctccggacgggg
tggtcgcgccagtccagccgcacgaggcggtccaagcccccggcgggagtgacgggcctc
ctgccgcagatcgtgacccacgggctgacggaccccggccgggctgaccgcagggtccgc
atcaacatcagcgggatgaagttcgacaccagggagagggtgcttctcaggtatccccaa
accctcctcggcgacgttgtccggcggcaacggttctacgtcccggaggaagaggaatac
ttcttcgaccgacaccgaccgagcttcgagggaattttccgctactatcaaacgggcaag
atcgaacgacctcgcaacgtaccacaggacgttttcgcggcagaactggcatatttcgac
atggggaaacttgtcatcaacaaatttcttaaagacgaagggtacgatgtatcggagaac
gtcttacctgaaaaagaaccccagagaacggtatggattcttttcgaaagccatgatggt
attttggccaaattcgtcggcctaattacggttttgtttatcctactgtcggtggggacg
tcttgtgcagagacactaccccgcttccgtaacctcacagaccagacgttcgcacatgca
ggtgacgtcaaagcgaaccttaacatcgccttcagtaacatcttctttcagattgaaaca
gcgtgtatcgtctggttctgcattgaactcgccatgcgtttttatgcaagcccaagaaaa
aggcggtttgtcaaggacatcatgaatattctggatttcgtggtgatcttgccttacttc
gtcgatctcatcttgattgtggcgaacgttgaccccacggggtctaacatcatccctgct
acgatagtacgcgtgctgcgattggtccgtgtcttcagaatcttcaagctatcaagacat
atgagagcgcttcagatgctggccgccacactgagagccagcgctcctcagctcatcatg
ttggtgttcttcatggccatcctggttgttctgtactccagtatcatctacttcatggag
atggaccatcctgaccacttcttcccaagtataccagcggcgttctggtgggcgatcatc
actctcaccacggtaggctacggcgacatttacccaaaaacaccctggggcaaggccttc
gcctgtatctgcgtcatcagcggtatcctggtcatcgccatgcctatgcctatcatcaca
aagaacttcgaaaaattctacaaaaagaacgggaacaacccgtttaaagccctgccactg
aacaacgggcatgaggaaagagatgacaacagttcagaacacagaaagcgaacctatgcc
gtacggctgactgacatcgagacagaggaacatgaaagctttttgaaagatgaggatgag
agtagttctggatttctctcatccgtatag

DBGET integrated database retrieval system