KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_121593Help
Entry
BRAFLDRAFT_121593 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BRAFLDRAFT_121593
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BRAFLDRAFT_121593
Enzymes [BR:bfo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BRAFLDRAFT_121593
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 163 aa AA seqDB search
MNALKEKMVGQLGFDFDILAFPTNQFGLQEPETNGEILNVLKYVRPGGGYVPNFPLFQKG
DCNGENEQSLFTYLKSCCPPASDMIVDDKSSLYWKPLRAGDVRWNFEKFLVDPEGKAVMR
FTPPVEPAEMEPVIEEFLRKWNVKVQREISAMEDLLSDLMIEQ
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcactcaaggagaagatggtcggccagctgggcttcgatttcgacatcttggct
tttccgaccaaccaattcggtctgcaggagcccgagacaaacggcgagattctcaacgtg
ctgaagtacgtgaggccaggcggtggctacgtgccgaactttcccctgtttcaaaaggga
gactgcaacggagagaacgagcagtcactcttcacttatctgaagagctgctgtcccccc
gctagtgacatgatagttgacgacaagtcgagtctgtactggaagccgctgcgggccgga
gatgtgcgctggaacttcgagaagtttctggtggacccggaagggaaggctgtgatgagg
ttcacccctccggtcgagcccgctgagatggagcctgttatcgaagagttcctccgcaag
tggaatgtcaaagtgcagagggaaataagcgccatggaggatcttctctccgacctgatg
atcgaacagtaa

DBGET integrated database retrieval system