KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_122758Help
Entry
BRAFLDRAFT_122758 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Module
Keratan sulfate degradation
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BRAFLDRAFT_122758
  Lipid metabolism
   00600 Sphingolipid metabolism
    BRAFLDRAFT_122758
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    BRAFLDRAFT_122758
   00604 Glycosphingolipid biosynthesis - ganglio series
    BRAFLDRAFT_122758
   00511 Other glycan degradation
    BRAFLDRAFT_122758
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    BRAFLDRAFT_122758
Enzymes [BR:bfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     BRAFLDRAFT_122758
Exosome [BR:bfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BRAFLDRAFT_122758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 551 aa AA seqDB search
MAATVKMFVALSLFVLVLQGQRAAGRSFSIDYDNNTFLKDGEPFRYISGSIHYSRVPRSY
WQDRLTKMYAAGLNAIQTCTDPAGAFKGQRKHQPKGPLVNSEFYTGWLDHWGQPHAHTDK
DKVATYLEKILELNASVNMYMFEGGTNFGYMNGVPGETTFRPVPTSYDYDAPLSEAGDLT
DKFYSIRNVISKFRHLPPGPVPPATPKAAYGKVQMTFEATVLDKLTDLSPDGPIRADYPI
TMENMQQSYGFMLYRTTLTAAATGAKLSVPGIRDRGYVMLDETPAGILSRNGPMDLNLTA
QAGQVLDIVVENQGRINFGRYINDSKGIIANVTLGNDTLRSWSIYSLDIDGALPTLFSQP
SNPAVDIDGSLPPLSYVLQNDIEGIDGQLTNQEKRSTQPRRSRAGQMVPSFYTGTFSIQD
TPQDTFLNMRGWTKGQAFVNGFNLGRYWPVEGPQITLYVPASVLKSENNITLFELEASPC
NMAQSSDADCTVEFQDRPIINATVSRHRGEKYDSTATDSAPPQLDAFVAVVLGVVFSVAY
PISTVLNIMLS
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggctgccactgtgaagatgtttgttgctttgtctttgtttgtgctcgtcttgcaggga
caaagagcagccggacgcagctttagtatcgactatgataacaacacgttcctgaaggat
ggcgagccgtttcgctacatctccggcagcatccattattcccgtgttccccgcagctac
tggcaggacagactgacaaagatgtacgctgcggggctcaacgctatccagacgtgtaca
gatccagctggtgccttcaaggggcagaggaaacatcaacctaaaggccccttggtgaac
tcggagttctacactggttggttggaccactggggacagcctcacgcacacacggacaag
gacaaggtggccacatacctggagaagatactggaactcaacgccagcgttaatatgtac
atgtttgaaggaggcaccaattttggctacatgaatggtgtccctggggagaccaccttc
cggcctgtccctacgtcttacgactacgatgcacccctgtcagaagccggggatctgacc
gataagttctacagtatacggaatgtgatcagtaagttccgccacttgccaccagggccg
gtaccccctgccacacctaaggcagcttatgggaaagtccagatgacatttgaggccaca
gtgctggataagttgactgacctgtcaccagatggaccaatcagagctgactatcccatc
accatggagaacatgcaacagagctatgggttcatgctgtacaggactactctaactgct
gcagctacaggagccaaactgtctgtgccaggcatcagggacaggggctatgtcatgcta
gatgagactcctgctggtatcctgagccgtaacggccccatggacttgaacctgacggca
caggcaggtcaggtattggacatcgtggtggagaaccaaggtcgcatcaacttcggcagg
tacatcaacgactccaagggcatcatcgcaaacgtgaccctcggaaacgacaccctccgt
tcctggtccatctactcgttagacatcgatggcgccctccctacgctgttctcacaacct
tccaatccggctgttgatattgatggcagcctcccacctctgtcttatgttctgcagaat
gacatagagggcatcgacggacagttgaccaatcaggagaagcgtagcacacagccacgg
cgatcccgggcaggccagatggtaccgtccttctacacgggaacgttctccatccaggac
actcctcaggacaccttcctcaacatgaggggatggactaagggtcaggcatttgttaat
gggttcaacctgggccgctattggccggtggaagggccacagatcacgctgtacgttccg
gcaagcgttctgaaatccgagaacaacatcacgctcttcgaattggaagcatcgccgtgt
aatatggcgcaaagttcagacgccgactgtaccgttgagttccaagatcgaccaatcatc
aatgcgactgtgtcacgccatcgaggtgaaaaatacgacagcaccgccactgactctgcc
ccccctcagcttgatgcgtttgtagctgttgtattgggtgttgtgttctctgtagcatat
cctatcagcacagtgcttaacatcatgctttcataa

DBGET integrated database retrieval system