KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_123517Help
Entry
BRAFLDRAFT_123517 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Brite
Enzymes [BR:bfo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     BRAFLDRAFT_123517
Transfer RNA biogenesis [BR:bfo03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    BRAFLDRAFT_123517
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 550 aa AA seqDB search
MGKNKKKGAGVTASPQEQMVLTVSDIVKQLIEAHEQGKDVNLNRIKSLTARKYGLPNQPR
LVDIIAGVPPAYKKVLYPKLKAKPVRTASGIAVVAVMCKPHRCPHINMTGNICVYCPGGP
DSDFEYSTQSYTGYEPTSMRAIRARYDPFLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMA
LGEDYRDYFIRNLHDALSGHTSNTVDEAVKYSEKSHTKCIGITIETRPDYCLKRHLSSML
SYGCTRLEIGVQSVYEDVARDTNRGHTVKAVCESFHMSKDAGFKVVCHMMPDLPNVGLER
DIEQFIELFENPAFRPDGMKIYPTLVIRGTGLYELWKTGRYKSYPPSTLVDLIARILALV
PPWTRIYRVQRDIPMPLVTSGVEHGNLRELALARMKDLGTQCRDVRTREVGIQEIHHKVR
PYEVELIRRDYVANGGWETFLSYEDPEQDILIGLLRLRKCSEETFRPELKGGCSIVRELH
VYGSVVPVSSRDPGKFQHQGFGMLLMEEAERIAREEHGANKIAVISGVGTRNYYRKIGYE
LEGPYMVKKL
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaacaagaagaaaggagcgggcgtgactgcctccccccaggagcagatggtc
ctgaccgtgtcggacatcgtcaaacagctgatcgaggctcatgagcagggaaaggatgtc
aatctcaacagaattaagagcctgacagcgaggaagtatggtcttcccaaccagccccgt
ctggtggacatcatcgcgggagtcccgccagcgtacaagaaggttttgtaccccaaactc
aaggccaaacctgtccgaacagccagcgggatcgccgttgttgcagttatgtgcaaaccc
cacaggtgtccccacatcaacatgacaggaaacatctgtgtgtattgtccaggaggacca
gactctgactttgaatattctactcagtcttacactgggtatgagccaacgtcgatgcga
gccatccgtgccagatacgacccctttctacagaccagacacagggtggagcagttgaag
cagctgggccacagcgtggataaggtagagtttatcgtgatggggggaacgttcatggcg
ctgggggaggattacagggactacttcatcaggaacctgcacgacgccctgtccggacac
accagtaacactgtagatgaggccgtcaagtactctgagaagagccacaccaagtgtata
gggatcaccatagagaccagacctgactactgtcttaagagacacctcagctccatgctg
tcttatggctgcaccaggctggagataggagtacagagtgtgtatgaggatgtggccagg
gacactaacagaggtcacacagtgaaggcagtgtgcgagtccttccacatgtccaaggac
gcagggttcaaggtcgtatgtcacatgatgccggaccttcccaacgtgggactggagaga
gatatagaacagtttattgagctgtttgagaacccagccttccgcccggacggtatgaag
atctaccccaccctggtgatccgtgggacggggctatacgagctgtggaagactggcagg
tacaagagttacccccccagtaccctggtggacctcatcgctaggatcctggccctggtg
ccaccatggaccaggatatacagagtacagagagacatccccatgccgctggtgacatct
ggagtggaacacgggaacctgcgggaactggccctggcacgcatgaaggatctgggaact
cagtgccgggatgtgagaacgagggaagttggtatacaggaaatccaccacaaggttcga
ccatatgaggttgagctgatcaggagagactatgtagctaacggaggttgggagacgttc
ctgtcatacgaggacccggagcaggacatcctgattggtctactcaggctgcgcaagtgc
tcggaggaaacattccggccagaactgaaggggggctgctccatcgtcagggaacttcat
gtatatgggagtgtagtacccgtgagctccagggacccagggaagttccaacatcagggc
tttggcatgctactgatggaggaggctgagaggatagctagagaggagcatggagcaaac
aagattgctgtcatttctggtgttgggaccagaaactactaccggaagattggatatgag
ctggagggaccgtacatggtcaaaaagctctga

DBGET integrated database retrieval system