KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_123545Help
Entry
BRAFLDRAFT_123545 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bfo00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bfo00051]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 274 aa AA seqDB search
MSSFAPASSKKAKKRAAADGVDGEFFPGIQKIEYRPDAGPEDVLCFKHYNASEIVYGKSM
EEWLRFSVCFWHTFRGTGADPFGFPTLHRPWEDGSDSMENAKRRLKAAFEFFTKLGVKYW
TFHDRDIAPEGNDLAETNRNLDEVVDLAVKLQDETGMKLLWGTCNLFANPRYMNGAATNP
DAHIVAHAAAQVKKGLEVTKRLGGQNFVFWGGREGYHTILNTDVLAELSHMASFFKMAVA
HKKKIGFTGQFLLEPKPKEPTKHQYDYGQWEPLT
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcctttgcaccagcttcgtctaaaaaggccaagaaaagagccgcagccgatggg
gtagacggggagttctttccaggtatccagaagatcgagtacaggcctgatgctggtcca
gaggatgttctctgtttcaaacactacaatgcctcagagattgtgtatgggaagtccatg
gaagaatggctgaggttttctgtctgtttctggcacaccttcaggggcacaggtgcggat
cccttcggtttccccaccctgcaccgcccctgggaggatggttcggactccatggagaat
gccaagaggagactgaaggctgcctttgagttcttcacaaagttgggggtaaaatattgg
acattccatgaccgggacattgctccagaggggaatgatctggcagaaaccaacaggaat
ttggatgaggtcgttgatctggctgtgaaactgcaggatgagacaggaatgaaactgctg
tgggggacctgcaacctgtttgccaatcctaggtacatgaacggtgcagccaccaaccca
gatgctcacatcgtggctcatgctgcagcacaggtcaagaaggggctagaggtcaccaaa
cgcctgggcggccagaactttgtgttctggggagggcgcgagggttaccacactatcctg
aacacagacgtgctggctgagctgtctcacatggccagcttcttcaaaatggcagttgca
cacaagaagaagattgggttcacaggccagttccttttggagcccaaacccaaggaacct
accaagcaccagtacgactatggtcagtgggaaccattgacttga

DBGET integrated database retrieval system