KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_123719Help
Entry
BRAFLDRAFT_123719 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:bfo04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 393 aa AA seqDB search
MPLSVPPSPGQPSERVRVLSEKAATVSVEDSIAPRMYFRSGVEMVRMATVYHEEGNLEAA
FILYMKFITLFVEKLPKHPEYKSAAAKEKQTTKRKLEMVFPVAEKCKKKLTEKYTTDLKE
WEIEKLKIEEQIAIERAKEAERQRQIEEDRRMAESLMEEEKEEIRKESQEEQYRRLQEQK
RLEQEREKERTLEEKAVPPGVLPLDGVVPFNVPSSNKYGLRQVVVPQEIMLKFLNLAQPN
TAQNIETCGILAGKLKQNSFTITHVLVPKQSGTPDSCTTLSEEELFDFQDKHELITLGWI
HTHPTQTAFLSSVDLHTHCSYQLMMPEAIAIVCSPKHQQTGIFMLTPNHGLNFVASCRQK
GFHPHPKEPPLFEDCCHVKMVTTESVVMVDLRK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgccgttgtcagtgccgccatcgccggggcaaccgtcggagcgtgtccgcgtgctgtcg
gaaaaggctgccacggtatcggtggaggactccatcgcaccgaggatgtacttccgctcg
ggggtggagatggtcaggatggccacagtctaccacgaggaaggaaatctggaagcagct
tttattctctatatgaagttcatcacgttatttgtggagaagcttcccaagcaccccgag
tacaagtctgcagcagccaaggagaagcagaccaccaagcggaagctggaaatggtgttt
cctgtggcagaaaagtgcaagaagaaactgacagagaaatacaccactgatctcaaggaa
tgggagattgaaaagctaaaaattgaggagcagattgcaatagagagagcgaaagaagct
gagaggcagcgtcaaatcgaggaggatcgacgcatggcagaaagcctaatggaggaggag
aaggaagaaatacggaaagagtctcaggaggaacagtacagaagactgcaggaacaaaag
aggctagagcaggagagagaaaaagaaaggactttggaagagaaggcagttcctcctggt
gtcctcccactagacggggtggttcccttcaatgttcccagcagtaacaagtacggcctg
agacaagtcgttgtccctcaggagatcatgctgaagtttttgaaccttgcccagccgaac
acggctcagaacattgagacttgtggtattctggctggaaaactgaaacagaacagtttc
accatcacccatgtgctggtccccaagcagagcggtactcccgactcctgcaccactctg
agtgaggaggaactatttgacttccaggacaaacatgaactcatcacacttgggtggatt
catactcatccgactcagacagccttcttgtccagtgtggatctccacacgcactgctcc
taccagctcatgatgccagaggccattgcaatcgtgtgctcccccaagcaccagcagacg
ggaattttcatgcttaccccaaaccatggcctgaacttcgttgccagctgcaggcagaaa
ggattccacccccatccaaaggagccaccattgtttgaggactgctgtcatgtgaaaatg
gtgaccactgaatctgttgtgatggtggacttaaggaaataa

DBGET integrated database retrieval system