KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_123769Help
Entry
BRAFLDRAFT_123769 CDS       T01074                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BRAFLDRAFT_123769
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BRAFLDRAFT_123769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 223 aa AA seqDB search
MALPRPVVICGPSGSGKSTLYNKLLKEFPGVFQLSVSHTTRQPRPGELNGREYHFINRDQ
FQENIKQGDFLEWAEFSGNIYGTSKKALEEVQSNNVIPILDIDTQGVRNVKKASLEAVYI
FIKPPSIDVLEKRLRSRKTETEEALQKRLSAARNELEYGLKPGNFQHIITNDDLDVAYEK
LKGILIKSQMPLAMATGSSSSVVNSFLDKPAASATTVNSSSQD
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgccccgacctgtggtgatctgcggcccctccggcagcggcaagtccacgctc
tacaacaaactcctcaaggagttcccgggggtcttccagctcagcgtctcacacaccaca
agacaacctcgaccaggggagctgaatggaagagagtaccacttcatcaacagggaccag
ttccaggagaacatcaagcagggagacttcctggaatgggccgagttttctgggaacatt
tatggaacaagtaagaaggcgcttgaggaggtacaaagtaacaacgtgatccccatcctg
gacatcgacacccagggggtcaggaacgtgaagaaggccagtctggaggctgtttacatc
ttcatcaagcctcccagtatagatgtgctggagaagcggctgagaagcagaaaaacagag
acggaggaggctcttcagaagagactgtctgcagccaggaatgaactggagtatggttta
aaaccaggaaattttcaacacatcatcaccaatgatgacttggatgttgcatacgagaaa
ttaaaaggcatcttaattaaatcccagatgcccttggccatggctacagggtcctcctca
tcagtggtgaacagttttctggacaagcctgccgcctcggccaccacggtcaactccagc
tcacaggactaa

DBGET integrated database retrieval system