KEGG   Branchiostoma floridae (Florida lancelet): BRAFLDRAFT_123769Help
Entry
BRAFLDRAFT_123769 CDS       T01074                                 

Definition
(RefSeq) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
bfo  Branchiostoma floridae (Florida lancelet)
Pathway
bfo00230  Purine metabolism
bfo01100  Metabolic pathways
Module
bfo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bfo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BRAFLDRAFT_123769
Enzymes [BR:bfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BRAFLDRAFT_123769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_33 MMR_HSR1 AAA_18 AAA_22 RsgA_GTPase ABC_tran AAA_16 RNA_helicase AAA_23 AAA_29 Dynamin_N AAA_14 T2SSE AAA_28 T3SS_needle_E ATPase_2 AAA SRPRB NACHT GTP_EFTU AAA_17 cobW Amidohydro_1 KRTDAP AAA_24 NTPase_1 M-factor
Motif
Other DBs
NCBI-GeneID: 7234956
NCBI-ProteinID: XP_002605108
JGI: 123769
UniProt: C3YEM4
AA seq 223 aa AA seqDB search
MALPRPVVICGPSGSGKSTLYNKLLKEFPGVFQLSVSHTTRQPRPGELNGREYHFINRDQ
FQENIKQGDFLEWAEFSGNIYGTSKKALEEVQSNNVIPILDIDTQGVRNVKKASLEAVYI
FIKPPSIDVLEKRLRSRKTETEEALQKRLSAARNELEYGLKPGNFQHIITNDDLDVAYEK
LKGILIKSQMPLAMATGSSSSVVNSFLDKPAASATTVNSSSQD
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgccccgacctgtggtgatctgcggcccctccggcagcggcaagtccacgctc
tacaacaaactcctcaaggagttcccgggggtcttccagctcagcgtctcacacaccaca
agacaacctcgaccaggggagctgaatggaagagagtaccacttcatcaacagggaccag
ttccaggagaacatcaagcagggagacttcctggaatgggccgagttttctgggaacatt
tatggaacaagtaagaaggcgcttgaggaggtacaaagtaacaacgtgatccccatcctg
gacatcgacacccagggggtcaggaacgtgaagaaggccagtctggaggctgtttacatc
ttcatcaagcctcccagtatagatgtgctggagaagcggctgagaagcagaaaaacagag
acggaggaggctcttcagaagagactgtctgcagccaggaatgaactggagtatggttta
aaaccaggaaattttcaacacatcatcaccaatgatgacttggatgttgcatacgagaaa
ttaaaaggcatcttaattaaatcccagatgcccttggccatggctacagggtcctcctca
tcagtggtgaacagttttctggacaagcctgccgcctcggccaccacggtcaactccagc
tcacaggactaa

DBGET integrated database retrieval system